KEGG   Desulfotomaculum nigrificans: Desca_2159Help
Entry
Desca_2159        CDS       T01498                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain II
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
dca  Desulfotomaculum nigrificans
Pathway
dca00010  Glycolysis / Gluconeogenesis
dca00030  Pentose phosphate pathway
dca00051  Fructose and mannose metabolism
dca00052  Galactose metabolism
dca00230  Purine metabolism
dca00500  Starch and sucrose metabolism
dca00520  Amino sugar and nucleotide sugar metabolism
dca00521  Streptomycin biosynthesis
dca01100  Metabolic pathways
dca01110  Biosynthesis of secondary metabolites
dca01120  Microbial metabolism in diverse environments
dca01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desca_2159
   00030 Pentose phosphate pathway
    Desca_2159
   00051 Fructose and mannose metabolism
    Desca_2159
   00052 Galactose metabolism
    Desca_2159
   00500 Starch and sucrose metabolism
    Desca_2159
   00520 Amino sugar and nucleotide sugar metabolism
    Desca_2159
  Nucleotide metabolism
   00230 Purine metabolism
    Desca_2159
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Desca_2159
Enzymes [BR:dca01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Desca_2159
    5.4.2.8  phosphomannomutase
     Desca_2159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: AEF94998
UniProt: F6BA29
Position
complement(2281337..2282698)
Genome map
AA seq 453 aa AA seqDB search
MAVNERIFRQYDIRGIFGEDLTVQDAALLGRAFGTFLRQKGESKAIVGRDNRESSPVLHE
HLVKGLLETGVDVIDIGVVISPIFYYATHLYGINAGIMITASHNPAKYNGFKVQYGGRTL
YGEELQQLKAMANRGVFEKGSGRLTCRWPADDYISMMKEKIVLGDRKLKVVVDCGNGTAG
LFAPAVMRELGCDVIPLYCESDPTFPNHFPDPVKTENLKDLITAVKENKADLGIGFDGDG
DRLGVVDEQGNILWGDMLMILFWREILPKYPGADAIVEVKCSDLLVNEIRRLGGKPFFYK
TGHSLIKAKMKEINAVFTGEMSGHMFFADEYYGYDDALYAAARLLRILSHSDKPLSELLS
DVPKTYCTPEIRVACEEDKKHQYVSHAKKYFKDKGYPFIDVDGVRVQFANGWGLVRASNT
GPELIIRCEAGSQDQLETIKQEIARSISPLKVA
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggctgttaacgagcgcatttttcgacaatacgacatccggggaatttttggcgaagat
ttaaccgtacaagacgcggccttgcttggtcgggccttcggtacctttctcagacaaaaa
ggtgaatccaaggccattgtgggccgggacaacagagaatcttctccggttctccacgaa
catttggtgaaggggttgctggagaccggcgttgatgtcatagacattggcgtggtcata
tctcccatcttttactatgctacccacctgtatggaatcaatgccggcatcatgatcacc
gccagtcacaaccctgcgaagtataacgggtttaaagtccagtatggcggcagaacgctc
tacggggaggaattgcagcaattaaaagcaatggccaaccggggagtttttgagaagggt
agcggtcggttgacctgccggtggccggctgatgactacatcagcatgatgaaagagaaa
attgtcctgggagacagaaagttaaaggtggtggtggactgtggcaatggcaccgccggc
ctttttgcccccgcagtaatgcgggagctgggatgtgatgtgattccgttgtactgcgaa
tcggacccgacatttcccaaccatttccctgacccggtgaaaacggaaaatctaaaggat
ttgattacggcagttaaagaaaacaaggctgatctgggtattggtttcgacggggacggc
gaccggctgggcgtggttgacgagcagggtaacatcctgtggggagatatgttgatgatc
cttttctggagggaaattctgcccaaatatcccggggccgatgccatagtggaggttaaa
tgttctgacctgcttgttaatgaaatccgacggctgggaggcaagcccttcttttataag
accggccattcattgattaaagccaagatgaaggagataaatgcggtttttacaggtgaa
atgtccgggcatatgttttttgcagacgaatattacggctatgacgatgccctttacgcc
gctgcaagactactgagaatcctttcccacagcgataaacctttgagtgaactgctgtcg
gatgtaccaaaaacctactgtacgcccgagattcgggttgcctgcgaggaagacaagaaa
catcagtatgtcagccatgccaaaaaatatttcaaagataagggctatccctttattgat
gtggacggcgtcagggtgcaatttgccaacgggtgggggcttgtccgggcttccaatacc
ggtccggaacttatcatccgttgtgaagcaggcagccaggaccaattggaaaccatcaaa
caggaaattgcccgctccatatctccgttaaaagttgcctga

DBGET integrated database retrieval system