KEGG   Desulfotomaculum nigrificans: Desca_2283Help
Entry
Desca_2283        CDS       T01498                                 

Definition
(GenBank) Aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
dca  Desulfotomaculum nigrificans
Pathway
dca00260  Glycine, serine and threonine metabolism
dca00630  Glyoxylate and dicarboxylate metabolism
dca00670  One carbon pool by folate
dca01100  Metabolic pathways
dca01110  Biosynthesis of secondary metabolites
dca01130  Biosynthesis of antibiotics
dca01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Desca_2283
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desca_2283
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Desca_2283
Enzymes [BR:dca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     Desca_2283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG Baculo_E66
Motif
Other DBs
NCBI-ProteinID: AEF95118
UniProt: F6B387
Position
complement(2398884..2399978)
Genome map
AA seq 364 aa AA seqDB search
MSELKRTPLYDEHLAAGAKMVEFGGWLMPVQYEGILKEHETVRSAAGLFDVSHMGEIQIT
GPGARELIQSIITNDVNRLTPGAALYTPMCHPTGGTVDDLLVYQLEENQYLLVVNAANIE
KDYNWVKVYANEGVEVKNVSDVTCQLALQGPRAIKILQKLTSVDLNEIKHFHFVYGPVEG
INCLISRTGYTGEDGFELYFPAEHARLLWRAILAAGQGEGIKPVGLGARDTLRFEACLAL
YGHELTDSVSPVMAGLGWTVKFNKGDFVGREALLQQKETGPSHKLVGLEMIDRGIPRQGY
TISKDGQEVGWITSGTFAPSIGKNLGLGYVAAQWVAVGTELDIMVRGKALKAKIVPKPFY
KREG
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaattaaaacgaacacctctttacgatgagcaccttgccgcaggggcaaagatg
gttgaatttgggggctggttaatgccggtccaatacgagggtattcttaaagagcatgag
accgtcaggtccgccgctggattatttgacgtttctcacatgggtgagattcaaattacc
ggtccaggggcccgggagttaattcaaagcataattaccaatgatgtaaatcgtctaaca
ccaggggcggccctgtatacccccatgtgtcaccccaccggtgggacagtggatgatttg
ctggtttatcagttggaggaaaaccagtacctgctggtggtcaatgccgccaatattgaa
aaggattataactgggtgaaagtctacgccaatgagggcgttgaggtaaaaaacgtatcg
gatgttacctgccagctggctttgcagggcccccgggccatcaagatactgcagaaattg
acctcggtggatcttaatgaaataaagcatttccacttcgtctacggcccggtggaggga
attaactgtttaatctcccgcaccggctacaccggggaagatggttttgaattgtatttc
ccggctgaacacgcccggctgctctggcgggccattttagctgccggccagggggaaggt
attaagccggttggcctgggagccagggataccctgcgttttgaggcttgcctggcctta
tacggacatgaacttaccgacagtgtttccccggtaatggctggccttggctggacggtg
aaatttaacaagggagatttcgtgggtagagaagccctgttacagcagaaagagacaggc
cccagccacaagctggtgggcctggaaatgattgaccgaggtattcctcgccagggttat
accatcagtaaagatggtcaagaggtgggttggattacttccggcacctttgcaccatcg
atagggaaaaatttaggcttaggttatgtggcggctcagtgggtcgctgttggcaccgaa
ctggatattatggttcggggtaaagcattaaaggccaagattgtgccaaaaccattttat
aaacgggagggctaa

DBGET integrated database retrieval system