KEGG   Desulfotomaculum nigrificans: Desca_2377Help
Entry
Desca_2377        CDS       T01498                                 

Definition
(GenBank) adenylylsulfate reductase, alpha subunit
  KO
K00394  adenylylsulfate reductase, subunit A [EC:1.8.99.2]
Organism
dca  Desulfotomaculum nigrificans
Pathway
dca00920  Sulfur metabolism
dca01100  Metabolic pathways
dca01120  Microbial metabolism in diverse environments
Module
dca_M00596  Dissimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:dca00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Desca_2377
Enzymes [BR:dca01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.99  With unknown physiological acceptors
    1.8.99.2  adenylyl-sulfate reductase
     Desca_2377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Pyr_redox_2 IF4E GIDA DAO FAD_oxidored NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AEF95212
UniProt: F6B3Q3
Position
complement(2498116..2499990)
Genome map
AA seq 624 aa AA seqDB search
MPNFETVVVNTDILILGGGMAACGAAVEAAYWAKKNGLKVTLVDKAAMDRSGAVAMGLSA
INQYLGVAKGENTVEDYVKYVKNDLMGIARDDLVANIARHVDSSVHLFEKWGLPIWKKED
GNYVRGGRWQIMLNGESYKVIVAEAAKNALGTDNIYERVYICEPIMDGDRIAGAIGFSTR
EEKVYVFKAKAVIAAMGGAVGVFKPRSTGEGLGRSWYPPFSSGSSAYFTMAAGAEMTCQE
VRFIPVRFKDAYGPVGAWFLLFKSRATNALGEEYMVTRRAELENWGPYGKVKPIPANLRN
YLGMLDTSAGLGPIYMQTAEAIANLAKEYEDDPKAFKKKMKELESEAWEDFLDMTVSQAM
LWAACNIAPEEKASEIAAAEPYFIGSHSGASGAWVSGPADIAPPEYQWGYTNMTTVKGLF
AAGDASGASSHKFSSGSHAEGRIAGKSAVRFVVENNQEPNIDDAKIEELKAKILKPLAIW
EEFSGFTTDPETNPNYILPRMYMFRLQKLMDEYAGGVVSNFTTSKALLEKGLEYLLMLKE
DGQKLAARNLHELMRCWENIHRTLQAEAHIRTVMFREETRWPGYYFRADEPKMKEDWEVF
VNCKYDAATGEWEMIKRPIIRLVD
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgccgaactttgaaactgttgtagtgaataccgacattctgatccttggtggcggtatg
gcagcttgcggcgcagccgttgaagcagcttattgggctaagaaaaacggcttaaaggtt
accttggtggataaggctgctatggaccgttccggtgccgttgctatgggtctgtctgct
attaaccaatacctgggtgttgctaaaggcgaaaacaccgttgaagattatgttaagtat
gttaaaaacgacctgatgggtattgctcgtgatgacttggtcgctaacattgcccgtcac
gttgactccagcgttcacctgtttgaaaaatggggtctgcccatttggaagaaagaagac
ggcaactatgttcgcggtggccgctggcagatcatgttaaacggtgagtcctacaaggtc
atcgttgcagaagctgctaagaacgctctgggtaccgacaacatttacgaacgtgtttac
atctgcgagcccatcatggatggtgacagaatcgctggtgctatcggtttcagcacccgt
gaagaaaaagtttatgtatttaaggctaaagccgttatcgctgctatgggcggtgctgta
ggcgtattcaagccccgttccaccggtgaaggtcttggccgttcctggtatcctccgttt
agctccggttcctctgcttacttcaccatggcagctggcgctgaaatgacctgccaggaa
gttcgtttcatccccgtacgttttaaagatgcttacggtcctgtaggtgcttggttcctg
ctcttcaaatcccgtgctaccaacgctctgggtgaagagtacatggtaacccgccgcgcc
gaactggaaaactggggtccctatggcaaagttaagcccatccctgctaacctgcgcaac
tacctcggtatgttagataccagcgctggtttaggccccatctacatgcaaactgctgaa
gctattgctaacttggctaaagaatacgaagacgatcccaaggccttcaagaagaaaatg
aaagaactggaaagcgaagcttgggaagatttcctcgatatgactgtttctcaagctatg
ctgtgggcagcttgcaacattgctccggaagaaaaagcttccgagatcgctgctgctgaa
ccttacttcatcggttctcactccggtgcttccggtgcctgggtatccggtcctgctgac
atcgctcctccggaatatcagtggggctacaccaacatgaccactgttaagggcctgttt
gctgccggcgacgcttccggtgcttccagccacaagttctcctccggttctcacgccgaa
ggtcgtatcgctggtaagtctgccgtacgcttcgttgtagaaaacaaccaggagcccaac
attgacgatgctaagattgaagaactgaaggctaagatcctcaagcctctggctatttgg
gaagagttcagtggcttcaccactgaccccgaaaccaacccgaactacatcctgcccaga
atgtacatgttccgtctgcaaaagctgatggacgagtacgccggcggtgttgtatctaac
ttcaccaccagcaaggctctgttagaaaaaggtcttgagtacctgctcatgctgaaagaa
gacggccaaaaactggctgctcgcaacctgcacgaattaatgagatgctgggaaaacatc
cacagaaccctgcaggctgaagcccacatccgtaccgtaatgttccgtgaagagacccgt
tggcccggctactacttccgtgctgacgagcccaagatgaaggaagattgggaagtattc
gttaactgcaagtacgatgcagctaccggtgaatgggaaatgatcaaacggcccatcatc
cgtctggttgactaa

DBGET integrated database retrieval system