KEGG   Deinococcus soli: SY84_05860Help
Entry
SY84_05860        CDS       T04233                                 

Definition
(GenBank) siroheme synthase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
dch  Deinococcus soli
Pathway
dch00860  Porphyrin and chlorophyll metabolism
dch01100  Metabolic pathways
dch01110  Biosynthesis of secondary metabolites
dch01120  Microbial metabolism in diverse environments
Module
dch_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:dch00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SY84_05860
Enzymes [BR:dch01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     SY84_05860
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     SY84_05860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Pyr_redox_3 Pyr_redox Oxidored_nitro Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AKH16662
UniProt: A0A0F7JLW9
Position
complement(1178179..1178748)
Genome map
AA seq 189 aa AA seqDB search
MLRHVSFLPAFLDLRGVRVVVVGGGEVALRRTRTLLDAGAQVQVVAPEQHPDFAALPVTA
LTRHYRRGDLSGAALVVAATSSADVNDAVVRDARAQGSLVNDAGDAPRGNWRFPAQARRA
GVQVAVTSGRELPLLAQAIAERVASLLPDEATLDGWAARREIALTQPETVRAATLDALRR
DIRQSVGLA
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgccacgtgagtttcctcccagccttccttgatcttcgcggcgtgcgcgtcgtc
gtggtcggcgggggagaggtcgcgctgcgccgcacccgcaccctgctggacgccggggcg
caggtgcaggtcgtcgcgcccgagcagcacccggacttcgcggcgctgcccgtgacagcc
ctgacccgtcactaccggcggggcgacctgagcggcgcggcgctggtcgtcgccgccacg
agctccgccgacgtgaacgacgccgtggtgcgcgacgcgcgcgcgcagggttccctggtg
aacgacgccggggacgccccgcgcggcaactggcgtttccccgcgcaggcccgtcgcgcg
ggcgtgcaggtggccgtcaccagcggccgggagctgcccctgctggcccaggcaattgcc
gaacgcgtcgcgtccctgctgcccgacgaggccaccctggacggctgggccgcccgccgc
gagatcgccctgacccagcctgaaaccgtgcgggccgccacgctggacgccctgcgccgc
gacatccgccaatccgtggggctcgcgtga

DBGET integrated database retrieval system