KEGG   Dermatophilus congolensis: SAMEA4475696_1335Help
Entry
SAMEA4475696_1335 CDS       T05038                                 

Definition
(GenBank) Methylmalonyl-CoA carboxyltransferase 5S subunit
  KO
K03416  methylmalonyl-CoA carboxyltransferase 5S subunit [EC:2.1.3.1]
Organism
dco  Dermatophilus congolensis
Pathway
dco00640  Propanoate metabolism
dco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SAMEA4475696_1335
Enzymes [BR:dco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.1  methylmalonyl-CoA carboxytransferase
     SAMEA4475696_1335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like TGT
Motif
Other DBs
NCBI-ProteinID: SNV21760
UniProt: A0A239VIK0
Position
1:complement(1511761..1513263)
Genome map
AA seq 500 aa AA seqDB search
MTTQRQIGVTELALRDAHQSLMATRMALEDMVDACADLDQAGFWSVECWGGATFDSCIRF
LNEDPWERLRTFRKLMPNTRTQMLLRGQNLLGYRHYGDDVVDHFVEKAVENGMDVFRVFD
ALNDPRNLEHAIAAVKRAGGHAQGTVCYTTSPLHTVEGYVELAKQLADMGVDSIALKDMA
ALLKPQPAYDIVKAIKNELPDMQINIHCHSTTGVTLVSLMKAIEAGADVVDTAISSMSLG
PGHNPTESLQEMLEGTGYIANLNKELLKNVKQHFAKIKPRYQKFMSSYTVDTAIFDSQIP
GGMISNMESQLKQQGAADRLEEVLEEVPRVRKDAGYPPLVTPSSQIVGTQAVFNVLMGKY
KVLTAEFADLMLGYYGTTIGDMNPEVVEQAKAQTGKEPITVRPADLIEPEWDKLKEEAAN
IPGFDGTDEDVLTYAMFPKVAPGFWATRPEGPKNVGQSPEELEAERAAQAGDTKNGPIRV
PITYNVTVGGKSHSVTVKPA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcagcgacagatcggcgtcaccgaactcgcactccgcgatgcacaccaaagc
ctcatggcaacgcgcatggcactcgaagacatggtcgacgcctgcgcagacctggaccaa
gcaggtttctggagcgtcgaatgctggggcggagccactttcgactcctgcatccggttc
ctcaacgaagacccgtgggagcgcctacgcaccttccgcaaactcatgccaaacacgcgc
acacaaatgttgctgcgcgggcaaaacctcctgggttaccgccactacggggacgatgtt
gtcgaccacttcgttgaaaaagccgtcgaaaacggcatggatgttttccgggtcttcgat
gccctcaacgaccctcgcaacctcgaacacgccatcgctgctgttaaacgcgccggcggg
cacgcccaaggcaccgtctgctacaccaccagcccgctacacaccgttgagggctacgtc
gagctagccaaacagctagccgacatgggtgtggactccatcgctctcaaagacatggca
gccctactcaaaccccaaccggcttacgacatcgtcaaagccatcaaaaatgaactgcct
gacatgcagatcaacatccactgccactccaccaccggagtaaccctggtctccctcatg
aaggctatcgaggcaggtgcagacgtcgtcgacaccgccatcagctccatgtccctaggg
ccgggccacaatcccaccgagtccctccaggaaatgctcgaaggcaccggttacatcgct
aacctcaacaaagagctactgaaaaacgtcaaacagcacttcgccaaaatcaaaccccgc
taccagaagttcatgtcgagctacaccgtcgacaccgccatcttcgatagccaaatcccc
ggcggcatgatctccaacatggagtcccagctcaaacagcagggagctgccgaccgcctc
gaagaagtactcgaagaggtaccccgcgtccgcaaagacgccggataccccccactcgtg
actccctcgagccaaatcgttggcacgcaagcggtgttcaacgtactcatgggcaaatac
aaagtcctcaccgccgagttcgccgacctcatgcttggctactacggcaccaccatcggc
gatatgaaccccgaggtggtcgaacaagccaaagcgcaaacaggcaaagagcccatcact
gtccggcctgccgacctcatcgaacccgaatgggacaagctcaaagaggaagcagccaac
atccccggcttcgacggcactgatgaagacgtcctcacctacgccatgttccccaaagtc
gcccctggcttctgggctacccggcctgaaggacccaagaacgtcggccaaagccccgaa
gagctcgaagcggaacgtgcagcccaagccggagacaccaagaacggacccatccgcgtc
cccatcacctacaacgtcaccgtcggaggcaagagccactccgtcaccgttaaaccggcc
tga

DBGET integrated database retrieval system