KEGG   Daucus carota (carrot): 108193037Help
Entry
108193037         CDS       T05350                                 

Definition
(RefSeq) apyrase 2-like
  KO
K14641  apyrase [EC:3.6.1.5]
Organism
dcr  Daucus carota (carrot)
Pathway
dcr00230  Purine metabolism
dcr00240  Pyrimidine metabolism
dcr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108193037
   00240 Pyrimidine metabolism
    108193037
Enzymes [BR:dcr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     108193037
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDA1_CD39
Motif
Other DBs
NCBI-GeneID: 108193037
NCBI-ProteinID: XP_017215092
UniProt: A0A164X5G9
Position
6
AA seq 467 aa AA seqDB search
MKQRNRQSDSFSDQIHRYRSIILVIAVPLLLISFVLFVMTTRSDTIDDSVLSHRKFASGG
GGSDKKFAVIFDAGSSGSRVHVFCFDRNLDLVPIGNDLELFEQLKPGLSAFAKDPKAAAN
SLQPLLEKAEAVVPQEIRPKTVVRVGATAGLRQLEGDASDRILQSVRDYLQYNSKLKSKS
DSVTVLDGTQEGAYQWVTINYLLGRLGKTYADTVGVVDLGGGSVQMAYAISENDAAKAPK
VTEGQDSYVKEMYLKGTKYYLYVHSYLRYGLLAARAEILQITGDSGSPCIVPDFSGSYKY
GGTVYKAAHSPSGSSLQKCREVATKALKVNESTCTHMKCTFGGVWNGGGGDGQKNLFVAS
FFFDRAAEAGFVDPKKPVAKVRPVDFEDAAKRACQTNLEEAKSIYPRVEADNLPYLCMDL
VYQFTLLVDGFALDPWQEITLVKKVEYRNSQVEAAWPLGSAIEVVSS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagcggaatcgccagtccgactccttctccgatcagattcaccggtaccggagc
attattctcgtgattgcggtgccgcttttgttaatctcgtttgttttgtttgttatgacc
actcggtcggatacgattgacgattcggtgctttcgcatcggaaatttgcgtctggaggt
ggcgggagtgataagaagtttgcggttatttttgatgccggtagttcggggagtagagtt
catgttttttgttttgataggaatttggatctggtgcctattggaaatgatctcgagctt
tttgaacagttgaaaccaggtttgagtgcatttgcaaaggatcctaaggccgcagcaaat
tctttacagccccttcttgagaaagctgaggctgtggttccacaagagattcgtcccaag
actgttgtcagagtcggggcaactgcaggtcttaggcaattagaaggtgatgcatcagac
agaattttgcaatcagttagagattacctccagtataacagtaagctcaaatcaaagtct
gattcagtgactgttcttgacggaactcaggagggtgcttatcagtgggtcactataaac
tatttactagggcgtttagggaaaacatatgcagatactgttggagtagttgatcttggt
ggtggatctgtacaaatggcgtatgccatttcagaaaatgatgctgccaaggctccaaaa
gtaacagaagggcaagactcttatgtgaaggaaatgtatctcaagggaaccaaatactac
ctttatgttcacagttacttgcgctatgggttattggcagctagagctgagattttgcaa
attactggcgactctggaagcccatgcattgtacctgacttttcaggatcttataaatat
ggagggacggtatataaagcagcacattctccttctggttcgagcttgcaaaaatgcagg
gaagtagctacaaaggctctgaaggtaaacgagtcaacatgcacccacatgaaatgcaca
tttggtggggtatggaatggtggaggcggtgatggacagaaaaatctatttgttgcatca
tttttctttgacagggctgctgaggctggttttgtcgatccaaagaagcctgttgctaaa
gttcgtccagtggattttgaagatgctgccaagcgtgcatgtcaaacaaacctagaggaa
gccaagtctatataccctcgagtagaggcagataatctaccatacttatgtatggacctt
gtttatcagttcacattgctggttgatgggtttgcccttgatccatggcaagaaattaca
ttggtgaaaaaagttgaataccggaattctcaagttgaggctgcatggccactaggcagt
gcaatcgaggttgtttcctcctga

DBGET integrated database retrieval system