KEGG   Daucus carota (carrot): 108193169Help
Entry
108193169         CDS       T05350                                 

Definition
(RefSeq) rust resistance kinase Lr10-like
Organism
dcr  Daucus carota (carrot)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr GUB_WAK_bind APH Kinase-like Phage_holin_3_6 Pkinase_fungal ATP-synt_I YukC
Motif
Other DBs
NCBI-GeneID: 108193169
NCBI-ProteinID: XP_017215195
Position
7
AA seq 665 aa AA seqDB search
MQNPRQMMSLCLRIVIIALLSVASCSLKVHKTPISPSDVSSYSCNMNYNISCPSYLQGHP
QNCPKLSFALFCENNRTFLTLADADAEFSVEAINYANSSIRITRSDFATCSSFPLIPYSH
DYDTMRDFSSPLGEYNTALTFIACSTPVINSSISRRYKRTSVCSSSSVTSYVVIGYMDYS
EVENNCTIQKTSWVSSAWPGINKTSFMDIHDFTYGIELPFRYLACLKCPAPQSPYCLSVR
NENYQFDCEPADSWLPVILFSLEIAVGALAGGLAYILAFLHACLLIFMAQTDIGPPELLA
AGFLLPVTARFLCGMAFLLVFLVYKLKRRHLSAYDTIEDFLQGQNNLMPIRYTYSQIKKF
TKGFKVKLGEGGFGTVYKGKLRSGHVVAVKMLSNYKANGQDFINEVGTIGRIHHVSIVRL
VGYCVEGPKHALIYEYMSNGFLDKSIFKDGDEDDGVTTLSSEKIYEKSWKVECDIEYLPR
GCDMQILHFDIKPHNILLDENFNPKISDFGLAKLRSTGDCTVTMTAARGTMGYMAPELFY
KNIGGVSYKADVYSFGMLLMEMAGKRKNLNPYVDQSSEIYFPSWIYDQVKEGKEIETEDA
SDIEKELVKKMIIVAMWCIQMKPIERPSMNKVIEMLEGDLELLVMPPKPLICPQETPGTE
DQELD
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatccacggcaaatgatgtcgctgtgtttacgaatcgttatcatagcgctgtta
tcagtagccagctgctccctcaaagttcacaaaactcccatttcaccttcggatgtttct
tcttattcttgcaatatgaattataacatcagctgcccttcttatctccaaggtcatccg
cagaactgccccaagttaagcttcgcactcttttgcgagaacaatcggacttttctaaca
cttgccgatgccgatgccgaattctctgtggaggctatcaattatgcgaattcttctatt
cggataactcgctcggacttcgccacgtgctcctcctttcctctcattccttacagccac
gattatgacacaatgagggatttttcttctccgcttggggagtataatacggcattaaca
tttatagcctgttcaactcctgtgatcaattcttcaatatcaagaagatataaacgcacg
tctgtgtgctcatcatcgtcagtcacctcgtatgttgtcatcggatatatggactactca
gaagtggaaaacaattgcacaattcagaagacgagttgggtgtcatctgcgtggcctggt
attaataaaacatctttcatggacattcacgatttcacttacggcatagagcttccattc
cgctacttggcctgcttaaagtgtcctgctcctcaatcgccatattgtttgagtgttaga
aatgaaaattatcaatttgattgcgagcctgcagattcttggctccccgtcattttattc
agtttggagattgcagtaggagcgctcgcgggcggtttggcttacattttggcctttctt
catgcctgccttttaattttcatggcgcagacagacataggacctccggagttgctggcc
gcgggatttctcctacctgtaactgcaagatttttgtgtggaatggcatttcttttagta
tttcttgtatacaaattgaagagaagacacttatcagcgtatgacaccatcgaagacttc
ctgcaaggtcaaaacaatctcatgcctattaggtacacttactcccaaatcaagaaattc
accaaaggatttaaagttaaacttggtgaagggggctttggtactgtatataaaggaaaa
cttcgaagtggtcatgtggtagctgttaaaatgttaagcaactacaaggccaatggccaa
gatttcatcaatgaagttggtacaattggtaggatccatcatgttagcatcgtgaggctt
gttggctattgtgttgagggtccaaaacatgctctcatctatgaatacatgtctaatgga
tttcttgataaatccattttcaaagatggagatgaagatgatggagtcactactttgagt
agtgaaaagatctatgagaaatcttggaaagtggaatgtgacattgagtatctacctcga
ggttgtgacatgcaaatcttgcattttgatatcaagcctcataacatcctcctcgatgag
aatttcaatccaaaaatatctgattttggtcttgcaaaattacgttctactggtgattgc
actgtgactatgactgccgcaaggggaacaatgggctacatggctcctgaattattttac
aaaaatattggaggtgtttcttacaaggcggatgtttatagctttgggatgttgttgatg
gaaatggcgggaaaaagaaaaaatttgaatccttatgtggatcaaagtagcgaaatttac
tttccttcgtggatttatgaccaggttaaggaaggaaaggaaatagaaacagaagatgcg
tctgatattgaaaaagagttggttaaaaagatgattattgtagcaatgtggtgtatacag
atgaagccaattgagcgtccttcaatgaacaaagttattgaaatgcttgaaggggacctt
gaacttttggtgatgcctcctaaacctctgatttgtccacaagaaacccctggaactgaa
gatcaagaacttgattaa

DBGET integrated database retrieval system