KEGG   Daucus carota (carrot): 108194441Help
Entry
108194441         CDS       T05350                                 

Definition
(RefSeq) putative receptor-like protein kinase At4g00960
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
dcr  Daucus carota (carrot)
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dcr01001]
    108194441
Enzymes [BR:dcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108194441
Protein kinases [BR:dcr01001]
 Serine/threonine kinases: TKL group
  IRAK family
   108194441
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Stress-antifung APH Haspin_kinase EphA2_TM PRIMA1 ASFV_J13L Tmemb_9 TMEM154 DAG1 Pkinase_fungal TssO DUF3377
Motif
Other DBs
NCBI-GeneID: 108194441
NCBI-ProteinID: XP_017216876
Position
1
AA seq 673 aa AA seqDB search
MIIVISSRTSLFILCSIVICSVSVLGSEYFYHTCNNNANFTRNSLFKTNLDTAQAILMSD
ANTSNSGFYSASVGNGSDRVNALVYCRDDVKPDICRSCIKDSINKSREACPSTKEADVWY
TECVLRYSNASISNNLDTLPLVYLPNPGNASDMDQFNKVLRDLLDELKGQASQETFASGN
ESGPGFSTIYGLMQCSPDLSSVPCSNCLDGLMTSIYSCCGGKVGARIYNPSCQLRYETYL
FYNETIVEAPPPQLPPTPLPVPPSAAGKDDNRTRTIIIVIVVVIVSLVTLLLILMCIFKR
KQKKRTATARLLNDDVEDISSSESLQYEFVTIEVATSYFSDSNKLGQGGFGAVYKGTLQN
GQEIAVKRLSRGSNQGQQEFVNEVILVAKLQHRNLVRLLGFCFEGTEKLLIYEFVPNASL
DHFIFDSVKRSYLDWERRYKIIGGTARGILYLHEDSRLRIIHRDLKASNVLLDAEMNPKI
ADFGMARLFNLDETQGVTSRIVGTYGYMAPEYAMYGQFSVKSDVFSFGVLVLEILSGQKN
HSFRNGENVEDLASFAWKNWREGTPSNVIDPILRNSSGSIHEMIRCIHIALLCVQENVAN
RPTMASVVLMLNSFSHTLAVPSEPAFFMRSGIGEEVWSGTDNTNSRVSDKSVNRVNSVKY
SINEASLTDPYPR
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgattattgtaatctcttcgcgaacatctttattcattttatgtagtatagtcatatgc
agtgtttctgtcctcggctcggagtatttttaccatacctgtaacaacaatgctaatttt
accagaaacagcctttttaagacaaatctcgacaccgctcaagccatcctcatgtcggat
gcaaacactagcaactccggtttttattctgcctcggtgggcaatggctcggacagagtt
aatgctcttgtttattgtagagatgatgtgaaacctgatatctgcagaagctgtatcaag
gactcgataaacaaatcaagagaggcgtgtccttccactaaggaggcggatgtgtggtac
actgagtgcgtgctcaggtactcaaatgcttcgatttctaacaacttagatactttgcca
cttgtttatttaccgaatccgggcaatgctagtgacatggatcaatttaataaggttctt
agagacttgttggacgagttgaagggacaagcttcacaagaaacgtttgcttcagggaat
gaaagtggtccgggcttctcgactatctacgggctgatgcagtgcagccctgatttatct
tcagtaccgtgcagtaattgtctggatgggcttatgacaagtatatattcatgttgcggt
ggaaaagtaggagcacgtatatataacccaagctgtcagcttagatatgaaacttatctt
ttttataacgaaacaattgttgaagcaccacctcctcagctgcctccaacaccattgcca
gtgcctccatctgctgcgggtaaagatgataatagaacacggacaataattattgttatt
gttgttgtaattgttagtttagttacattgctgctcattcttatgtgcatattcaagaga
aagcaaaagaagaggactgcaaccgcgagattgctcaacgacgatgtggaagatataagt
agttctgaatcgttgcaatatgaatttgttacaattgaagttgccacaagttacttctca
gatagcaataaactaggacaaggtggttttggagctgtctacaagggcacacttcaaaat
ggtcaagaaatagctgtgaaaaggctttccagaggttcaaatcaaggtcaacaagaattt
gttaacgaggtcatattagtggcaaaattgcagcacagaaatttggttagactccttggt
ttctgctttgaaggaactgaaaagcttctcatctacgagtttgtgccaaatgcaagtctt
gaccacttcatattcgattcagtgaagcgttcatatttggactgggaaagacgctacaag
atcataggtggcactgcaaggggaattctttaccttcatgaagattctagactacggatc
attcatcgtgacttgaaagctagcaatgttttgctagatgcagagatgaatcctaaaatt
gcagactttggaatggctaggctattcaatttggatgaaactcaaggagttactagtaga
attgtgggaacctatggctatatggcgcctgaatatgcaatgtacggccaattctcagtt
aagtctgatgtgttcagcttcggtgtattggttctggaaatactaagtggtcagaagaac
catagtttccgaaatggggagaatgtggaggacctagcaagctttgcttggaagaattgg
cgagaagggactccatccaatgtcatagatccaatattgagaaacagttcaggatcaata
cacgaaatgataaggtgtattcacattgcactgctatgcgtacaagaaaatgtagcgaac
agacctaccatggcatcggtggtgcttatgctgaatagcttctctcacactcttgctgta
ccttcagagcctgctttctttatgcggagtggaattggtgaagaagtgtggtcgggtact
gataatacaaattccagggtgagcgacaaatccgtcaacagagtaaattctgttaagtac
tctatcaatgaggcttcattaactgatccatatcctagataa

DBGET integrated database retrieval system