KEGG   Daucus carota (carrot): 108195782Help
Entry
108195782         CDS       T05350                                 

Definition
(RefSeq) probable serine/threonine-protein kinase At1g01540
Organism
dcr  Daucus carota (carrot)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 108195782
NCBI-ProteinID: XP_017218228
UniProt: A0A164UBG3
Position
7
AA seq 473 aa AA seqDB search
MNDQKTSIFGLSLWVILGVSVGAAFVLVLFIISICFTSKRNNIKSIKNGSVSKAPSIPHV
SRDIQEIKVDNQEPERLSRNEQKALLLKAEEEGSTGYHQRIQIDIGKDHRILYPAGKLGG
GASSGEAKGDHHHVAKVVPQVSHLGWGHWYTLRELEDSTNGFAHENVIGQGGYGIVYHGV
LQDGTHVAVKNLLNNRGQAEKEFEVEVEAIGRVRHKNLVRLLGYCAEGAHRMLVYEFVNN
GNLEQWLHGEVGPYSPLTWEIRMNIILGTAKGLAYLHEGLEPKVIHRDIKSSNILLDKQW
NSKVADFGLAKLLGSGRSYTTTRVMGTFGYVAPEYASTGMLNDKSDVYSFGILVMELISG
RYPVDNSRPPDEVHLVDWLKQMVASRNSEGVLDPKLQEKPSLRSLRRAILVALRCVDPNT
QKRPKMGHVVHMLEAEDSYNERKAGKAPSSSQCDEQKDKSTEKPVKESGETSR
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatcagaaaacctcaatctttggcctaagtttgtgggttattctgggagtttct
gtcggagctgcttttgttcttgtcctttttataatctcaatctgcttcacttcaaaaaga
aacaacataaagagcatcaagaatgggtcagttagtaaagccccctcaattccacatgtg
tcaagagatatccaagaaatcaaagtggataatcaagaaccggagcgcttgtcgagaaat
gagcagaaagctttgcttttgaaagctgaggaggagggttcaactgggtatcatcaaaga
attcagattgatattgggaaagatcataggattttgtaccctgctgggaaattgggtggg
ggggcttcttctggggaggctaagggtgatcatcatcatgtggctaaggttgttccgcag
gtttctcatttggggtggggacattggtatacactgagggagcttgaggattctactaat
gggtttgctcatgagaatgtgattggtcaaggggggtatgggattgtttaccatggtgtt
ttgcaggatggtactcatgttgctgtcaagaatttgcttaacaatagaggacaagctgag
aaggagtttgaggttgaagtggaagcaattggacgtgttagacataagaatttggtgagg
ttgcttggctattgcgcagaaggagcacatagaatgctggtatatgagtttgtaaataat
ggtaaccttgaacagtggcttcatggcgaagtcgggccctatagtcctcttacatgggaa
attcggatgaatatcattcttggaacagcaaaagggttagcttaccttcatgagggactg
gaaccaaaagtgattcaccgagatataaaatcaagcaacattctacttgataaacaatgg
aattcaaaggttgcagattttggacttgcaaaactccttggttcagggaggagctacact
acaacccgtgttatgggaacctttggctacgtagctcctgagtatgccagtacaggcatg
ttgaatgataaaagtgatgtatatagttttgggattcttgtcatggaattaatcagcggg
aggtacccagttgacaatagtcggcctccagatgaggtgcacttggtagattggctgaag
cagatggttgctagcagaaactctgaaggagttttggatcccaagctccaagagaaacct
tctttgaggtcattaaggagagcaattttagtggctttgcgttgtgttgatccaaatact
cagaagaggccaaaaatggggcatgtggtacacatgcttgaagctgaagactcatacaat
gaacgaaaagctggaaaggcaccaagttcttcccaatgtgatgaacagaaagataaatct
acagagaagcctgtgaaggaatcaggtgaaaccagtaggtaa

DBGET integrated database retrieval system