KEGG   Daucus carota (carrot): 108196445Help
Entry
108196445         CDS       T05350                                 

Definition
(RefSeq) sphingosine kinase 1-like isoform X1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
dcr  Daucus carota (carrot)
Pathway
dcr00600  Sphingolipid metabolism
dcr01100  Metabolic pathways
Module
dcr_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    108196445
Enzymes [BR:dcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     108196445
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 108196445
NCBI-ProteinID: XP_017219229
Position
7
AA seq 491 aa AA seqDB search
MEQQNEGGDIVSELVKIKGVDTTLTLTCAGMLKWHDGQRLRCLTVEKEVLGFSTVGSQVF
VKTVVETPGLCCVGGGDKGLTRKTFVFEPLSEGSLQLWSRKLGQYIDSLGRPKKLLIFVN
PFGGRKSATKIFAADVKPLLDDANILYTMQETKHQLHAKEITYKMDLSMYDGIVCVSGDG
ILVEVINGLLEREDWDSAIRMPLGVVPAGTGNGMAKSLLDLVGYPCTALYAVLAVIRGHK
RSLDVATILQGETRFYCVLMLAWGLVADIDIESEKYRWMGSARMEFYALQRIFHLRTYNG
RIYFVPAPGFEAFGDELSGHTVECAKGICARGQNQEGMINIQQHGYRDSNIDLQSLNWRT
IEGPFISVWLHNVPWGSEDTMAAPDAKFADGYLDLIIMKTCSKLPLLALMAEMNNGKYVK
SPHVLYLKVKAFILEPGSQIADPSKEGIIDSDGEVLARGKGTYNCDQKSLLTYGKLQITV
DQGLATLFTPI
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggaacaacaaaatgaaggcggagacatcgtgtctgaattggtaaaaataaaaggtgta
gacacgacgttgacgttaacgtgcgccggaatgctgaagtggcacgacggtcagcgcctc
cggtgtttgaccgtggagaaggaagtccttggtttctccaccgtggggtcgcaagtgttt
gtgaaaactgtggtggagacacctgggctttgttgtgttggaggtggcgacaaggggctt
acgaggaagacgtttgtgtttgagcctctgtcggaagggtctttgcaactttggtctcgt
aagcttggtcaatatattgattccttaggacggccaaaaaagttgctcatatttgttaat
ccatttggaggaaggaaatctgctacaaagatctttgctgcagatgtaaaacccttgctc
gatgatgctaatatcctatatacgatgcaagaaactaaacatcagctccatgctaaggag
atcacatataaaatggatctgtcgatgtatgatggtattgtttgtgttagtggggacgga
atattggttgaggttataaatggactcctggagagggaggattgggattctgcaataagg
atgcctcttggagtagtacctgcaggtacagggaatggtatggcaaaatctcttttggac
ttggttggttatccatgtacagctctttatgcggttcttgctgtcattcgagggcacaag
cgttcattggatgtagcaactatcttgcagggagagaccagattttattgtgtattgatg
cttgcttggggtttggttgctgatattgacatcgagtcagaaaagtatcgatggatgggg
agtgcacggatggaattctatgctcttcaacggatattccatttgcggacctacaacggg
cgtatatattttgtacctgctcctggatttgaagctttcggtgacgaactaagtggacac
actgttgaatgtgctaaaggcatctgtgctcgtggtcaaaatcaagagggtatgattaat
attcaacagcatggataccgagactcaaatattgacctgcagagtttgaattggagaacg
attgaaggtccttttatttcagtctggcttcacaatgtaccctggggcagtgaggacacc
atggcagctcctgatgccaagtttgctgatggttatttggatctgatcataatgaagact
tgctccaagttacccttgctagctttaatggctgaaatgaacaacggtaaatatgtcaaa
tcaccgcatgtattgtatcttaaggtgaaggcattcattttagaacctggttcacaaatt
gctgatccatccaaggaagggatcatagactcagacggtgaggtgctggctagagggaaa
ggaacatataattgtgaccagaagtcactgctgacatacggaaagcttcaaataactgtg
gatcaaggtttagctacgctttttaccccaatttag

DBGET integrated database retrieval system