KEGG   Daucus carota (carrot): 108197033Help
Entry
108197033         CDS       T05350                                 

Definition
(RefSeq) receptor-like cytosolic serine/threonine-protein kinase RBK2
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
dcr  Daucus carota (carrot)
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dcr01001]
    108197033
Enzymes [BR:dcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108197033
Protein kinases [BR:dcr01001]
 Serine/threonine kinases: TKL group
  IRAK family
   108197033
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Pkinase_fungal APH RRM_1 Haspin_kinase RRM_3
Motif
Other DBs
NCBI-GeneID: 108197033
NCBI-ProteinID: XP_017220000
Position
1
AA seq 460 aa AA seqDB search
MEHKKNSDVSAHAATFKKLRRKFSSSSAQDLRYYETEKDNEGVSSPRGIIEACMSSMNKG
SESDDNSTSNPEASASNSKMHTRWRKFVNVWKVSPIKKLPLIPPKQLSKKSSSASENVAF
DLSNFNSPWKNFSLQELQNATCNFSPDNLIGKGGYAEVFKGSLTDGQLVAVKKLNKGTSE
EQIVGFLSEIGTIAHVDHPNTAKMVGYGVEGGTYLILELSPLGSLGSLLHGKKERLDWGA
RHKIIVGTADGLLYLHENCQRRIIHRDIKADNILLTENFEPQICDFGLAKWLPKQWSHHN
VSKFEGTFGYFAPEYFMHGIVDEKTDVYSFGVLILEIVTGRRAIDDSQKSLVLWAKPLLE
SSAIEELVDPSLGSLYNQEEMDCVLLTASVCIDQNPILRPRMSQVLEILRGDKYDPHCPR
VQQKRLLQRTYSEEINDAEEYNSTKYLHNVDRLKEIALET
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggaacataaaaagaactcagacgtcagtgctcatgcggcaacatttaaaaaattacgt
cgtaaattttcttcttcttctgcacaagatttgagatattatgagacggaaaaagataac
gaaggcgtttcctctcctaggggaatcatagaagcttgcatgagtagcatgaataaagga
tcagaatctgacgataatagcacatctaatcctgaagccagtgcatcgaattcaaagatg
catactcgctggcgtaaattcgtcaatgtttggaaagttagtcctattaagaagttacct
ttaattcctccaaagcaattaagtaaaaagagctcgagtgccagtgaaaatgtagccttt
gacttgagcaattttaattctccctggaaaaacttcagcctccaagaactccaaaatgca
acctgtaattttagtcctgataatttaattggaaagggtggttatgctgaagtattcaag
ggttctttgactgatgggcaacttgtggctgttaaaaagctcaacaaaggaacatctgaa
gaacagatcgtaggttttctatctgaaattggcactatagcacatgttgatcatcctaat
acagcaaaaatggttggttatggtgttgaaggggggacatatcttatacttgagttgtct
ccacttgggagtttaggatcgcttcttcatggaaagaaggagagattagactggggtgct
aggcacaaaattattgtagggacagctgatggtttgctgtatcttcatgaaaactgtcaa
aggagaatcattcacagggatattaaagcagataatattctgctcactgagaattttgag
ccccagatttgtgatttcgggcttgcaaaatggctaccaaaacaatggagccatcataac
gtatcaaaatttgaaggcacatttggctactttgctccagaatacttcatgcatggcata
gtggatgagaaaactgatgtttattcttttggggtgctaattttggagatagtgactgga
cgccgagctattgatgactcacagaaaagccttgtactctgggcaaaacctttgctggag
agcagtgcaattgaggaacttgttgatccttctcttggtagtttatataaccaagaggaa
atggattgcgtgctcttaactgcctctgtgtgtatcgaccagaatccaattcttcggcct
cgaatgagtcaggttctggagattttaagaggtgataaatatgacccccactgtccaaga
gtgcaacaaaagcgattacttcaaagaacctactcagaagagattaatgatgcagaagaa
tacaactcaacaaaatatttacataacgtcgatcgacttaaggaaatagctttggagaca
taa

DBGET integrated database retrieval system