KEGG   Daucus carota (carrot): 108197161Help
Entry
108197161         CDS       T05350                                 

Definition
(RefSeq) heat shock 70 kDa protein 18-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
dcr  Daucus carota (carrot)
Pathway
dcr03040  Spliceosome
dcr04141  Protein processing in endoplasmic reticulum
dcr04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    108197161
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108197161
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108197161
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dcr01009]
    108197161
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dcr03041]
    108197161
   03009 Ribosome biogenesis [BR:dcr03009]
    108197161
   03110 Chaperones and folding catalysts [BR:dcr03110]
    108197161
   04131 Membrane trafficking [BR:dcr04131]
    108197161
   03051 Proteasome [BR:dcr03051]
    108197161
   03029 Mitochondrial biogenesis [BR:dcr03029]
    108197161
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dcr04147]
    108197161
Protein phosphatases and associated proteins [BR:dcr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     108197161
Spliceosome [BR:dcr03041]
 Complex B
  Other components
   Prp19 complex
    108197161
 Complex C
   Prp19-CDC5 complex
    108197161
Ribosome biogenesis [BR:dcr03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    108197161
Chaperones and folding catalysts [BR:dcr03110]
 Heat shock proteins
  HSP70 / DNAK
   108197161
Membrane trafficking [BR:dcr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    108197161
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    108197161
Proteasome [BR:dcr03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    108197161
Mitochondrial biogenesis [BR:dcr03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    108197161
Exosome [BR:dcr04147]
 Exosomal proteins
  Proteins found in most exosomes
   108197161
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C
Motif
Other DBs
NCBI-GeneID: 108197161
NCBI-ProteinID: XP_017220180
Position
8
AA seq 1161 aa AA seqDB search
MAGRREGPAVGIDLGTMYSCVGVWQGSHVEIIANDHGSRTTPSCVAFSDTEILIGDAARN
QGGMNPDNTVFSVKRLIGRKFSDLSVQNDMKFWPFKVISNHGGKPMVLVTYKGQEKRFYA
EELSSMILIKMKEIVEKCLGSTVRNAVITVPAYFNDSQRNAIIDAGVISGINVIRVISEP
SAAAITYGLEKRKADSSTGGEKNVLVFDLGGSNCNVSLVVIEEGIFEVRATTGASHLGGE
DFVHRMVNHFIREIMRKNKKDITGNAKSIRRLKNACERAKRTLSSAAMTSIELEFLYDGV
SFSENISRDKFEELNMDLFKSCLELVEKCLRGGNIDKRNIHDVVLVGGSTRIPKVQQLLK
NFFNGKELCMSLNPDEAVANGAAVLAAILSGEGHEAVQDLMLLDVTPLSLGIGTSGETMS
VLIPKNTTIPTKREQIFSTSIDNQLDVLIEVFEGENPNTKDNNLLGKFVLSGISPAPKGV
PQFTVCFDIDAYGRLNVSAEDKTTGKKIKIKVTNNEERLSKEELEKMVKEAEKYRAEAKV
NKKATEKRMAGKGGPAIGLDLGTMYSCVGVWEGNHVEIIANDHGSRITPSCVAFSDTEVL
IGDAAYSQGGMNPNNTVFSVKRLIGRKFSDSKVLGDITFWPFKVISGPREKPVILVTYKG
QQKQFHVEEISSMILMKMKEIAENYLGSVVRDAVITVPAYFNDSQRNATVDAGVIAGLNV
MRIVAEPSAAAVAYGLEKKMAGSSTEGGKNVIIFDLGGSNCSVSLVVIEEGIFEVRATTG
ATHLGGEDFVNRMVSYFVKDFMRMYRKDISGNAKSVRRLRNACERAKRTLSSAAMTTIEL
EYLYDGADFSSNITRDRFEDLNMDLFNGCLELVEKCLTEASIDKRNIDDVVLVGGSTRIP
KVQQLLKHFFNGKELCLSMNPDEAVANGAAVLAAILSGEGNDTVQDLMLLDVTSLSLGIG
TSGETMSVMIPKNTTIPTKREQIFSTSIDNQLDVLIEVFEGENRNTKDNNLLGKFVLSGI
PPAPRGVPQFIVCFDIDAYGMLNVSAEDKTTGKKIKIKVTNNEERLSKEELEKMVKEAEK
FKAENSENKKAAEGRNALEDYIFKMKNVMSDEKFSSKLPFASRKKVENAMKLATQWLDRN
QTAKVEELEGIMKGLKGFAIA
NT seq 3486 nt NT seq  +upstreamnt  +downstreamnt
atggctggaagaagagaaggaccagcagtgggaattgatctgggaaccatgtactcatgt
gttggagtttggcaaggcagccatgtcgaaatcattgccaatgatcatggtagcaggacg
acgccatcttgtgtggctttttctgatacagaaattctgattggtgatgctgcacgcaac
cagggtggaatgaatcctgataacaccgtcttcagcgttaaacggttaataggcagaaaa
ttcagcgacttgagtgtacagaatgacatgaaattttggccctttaaagtcatttctaat
catggcggaaaacctatggtcttggtcacctataaggggcaggagaagaggttttacgcg
gaggaactctcctcaatgattctaataaagatgaaagaaattgttgagaagtgtcttgga
tcaactgtaagaaatgctgttattactgtcccagcttactttaatgactctcagcggaat
gcaattatagatgctggagttatttctggcattaatgtaatacgcgtaatttctgagcca
agtgcagcagcaattacatatggtcttgaaaagaggaaggcggatagtagtacaggcggt
gagaaaaatgtgcttgtcttcgatctaggtggtagtaattgtaatgtttctcttgttgta
attgaagagggaatttttgaagtaagggctaccactggtgccagtcaccttggaggagag
gattttgtccatcggatggtgaatcattttattcgggagatcatgaggaagaacaaaaag
gacataactggtaatgctaaatctattagaagattgaaaaatgcttgtgaaagggcaaag
aggacactctcttcggctgcaatgacatcaattgagttagaatttttgtatgatggtgtt
agtttctctgaaaatatttctcgtgacaaatttgaagagttgaacatggacctctttaaa
agttgtttggagctggtcgagaagtgtttgaggggtggcaatattgataagagaaacatc
catgatgtggtccttgttggtggatctactcgaattccaaaagtacagcagctattgaaa
aacttttttaacgggaaggagctctgcatgagtttgaatcctgatgaggctgttgcaaat
ggtgcagctgtgctagctgcaatccttagtggcgaaggccacgaagctgttcaggactta
atgctgttagatgtcactcctctatcccttgggatcggaactagtggtgaaacaatgtct
gtccttattccaaagaatacaactatccccactaagagggagcaaattttctcaacctcc
atagacaatcagcttgatgtgctgatcgaagtctttgaaggcgaaaacccaaataccaag
gataacaacttgctgggaaaatttgtactctctggcatttcccctgcacctaagggcgtc
cctcagttcaccgtttgctttgacattgatgcatatgggaggctaaatgtgtctgccgag
gataagactacagggaagaagatcaagataaaagtaaccaataacgaggagagattgtcg
aaggaagagcttgagaagatggtaaaagaagctgagaagtacagagcagaagctaaagtg
aacaagaaagcgacagagaaaagaatggctggaaaaggaggacctgcaataggacttgat
cttggaaccatgtactcatgtgttggagtttgggaaggtaaccatgtcgaaatcattgcc
aatgatcatggtagcaggattactccttcttgtgtggctttctctgatactgaggttcta
attggtgatgctgcatacagccagggtgggatgaatcctaataatactgtctttagtgtt
aaacgcttgattggcagaaaattcagcgactcaaaagtactgggtgatataacattttgg
ccatttaaagtaatctccggtccccgtgaaaagcctgtgatcttggtcacctataaaggt
cagcagaagcagtttcatgtagaggaaatatcctctatgatattaatgaagatgaaagaa
attgcagagaattatcttggatcagttgttagggatgctgttattactgtccccgcttac
ttcaatgactctcagcgcaatgcaactgtagatgctggagtcattgcaggccttaatgta
atgcgtattgttgctgagccgagtgcagctgcagtagcatacggccttgagaagaagatg
gcaggtagtagtacagaaggcggaaaaaacgtgataatctttgatcttggtggtagtaat
tgtagcgtctcacttgtcgtaattgaagagggtatttttgaagtaagggctacaactggt
gctactcacctcggaggagaggattttgtcaatcggatggtgagttattttgttaaggat
ttcatgaggatgtatagaaaggacataagtggtaatgctaaatctgttagaagattgaga
aatgcttgtgaaagggcaaagaggacactctcttctgctgcaatgactaccattgaactt
gagtatctgtatgatggtgccgatttctcttcaaatattacccgtgacagattcgaagac
ttaaatatggacctatttaacggttgtttagagttggtcgagaagtgtttgacagaagcc
agtatagataagagaaacattgatgatgtggtccttgttggtggatcaactcgaattcca
aaagtgcagcagctattgaaacactttttcaatgggaaagagctctgcttgagtatgaat
cctgatgaggctgttgcaaatggtgcagctgtgctggctgcaatcctgagtggtgaagga
aacgacacggttcaggacctaatgctgttggatgtcacttctctatcccttgggattgga
actagtggcgaaacaatgtctgtcatgatcccaaagaatacaactatccccactaagagg
gagcaaattttctcaacctccatagataatcagcttgacgttttgatcgaagtctttgag
ggtgaaaacagaaataccaaggataacaacttgctgggaaaatttgtgctctctggcatt
cctcctgcccctaggggtgttcctcagttcatcgtatgctttgacattgatgcatatggg
atgttaaatgtgtctgccgaggataagactaccgggaagaagatcaagataaaagtaacc
aataacgaggagagattgtcaaaggaagagcttgagaagatggtaaaagaagctgagaag
ttcaaagcagaaaattcagaaaataagaaggcagcagaggggagaaatgctctggaggat
tacatctttaagatgaagaacgtcatgagtgacgaaaaatttagctccaaacttccattt
gcgagcagaaagaaagtagagaatgctatgaagttggcaacacagtggttggataggaat
cagaccgcaaaggtagaagagttggagggaataatgaaagggctgaaggggtttgcaatt
gcttga

DBGET integrated database retrieval system