KEGG   Daucus carota (carrot): 108197433Help
Entry
108197433         CDS       T05350                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase-like
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
dcr  Daucus carota (carrot)
Pathway
dcr00601  Glycosphingolipid biosynthesis - lacto and neolacto series
dcr00603  Glycosphingolipid biosynthesis - globo and isoglobo series
dcr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    108197433
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    108197433
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dcr01003]
    108197433
Enzymes [BR:dcr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     108197433
Glycosyltransferases [BR:dcr01003]
 Glycan extension
  P blood group
   108197433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth TcdA_TcdB
Motif
Other DBs
NCBI-GeneID: 108197433
NCBI-ProteinID: XP_017220541
UniProt: A0A175YLP7
Position
8
AA seq 406 aa AA seqDB search
MFESRRPKLDIFLNLTFVATCLLLIFTVNIASKVYLQPELQSRDTRHSVEFDIEVRYRPY
EKRVIDEEESHMEDYGNIVPPINVTLWERMVWFKRNLPRFEFMKSTPVSMKFEERVEEFL
GGDQCRIQFFMTWIAPISLFGDREFLTMDSLFKAHPNGCLVIISRTLDSSQGLRILSPLV
DRGFKVLAVTPDLPQLFKDTPAESWFDDMKSGVKDPGEISLAQNLSNLIRLAVLYKYGGV
YLDTDFIVLKDFSGLRNSIGAQSMNKSGNWTRLNNAVLIFDKNHPLLYKFIEEFALSFNG
NIWGHNGPYLVSRVVSNLTSAQDYNFTILPPMAFYPVYWSRVDGFFMGPEQVRRRWIEHK
LQQLTDMTYGMHLWNKQSSRLTIEQGSIVQKLISEHCTICKHEYTS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatctcgcaggcctaagctggatatcttccttaatcttacttttgtcgcaacc
tgtttacttcttatttttacggttaacatagcttctaaggtttatcttcaacccgagctg
cagagtcgtgatacacgacattcagtagagtttgatattgaggttcggtatagaccctat
gagaagagagtgattgatgaagaggaaagtcatatggaagattatggcaatatagtgcct
ccgatcaatgtgacgttatgggaaagaatggtgtggttcaagagaaatttgcctcggttt
gagtttatgaagtctacccctgtgtcgatgaagtttgaagagagagttgaggagtttctt
ggaggtgatcaatgcagaatacagttttttatgacatggattgccccgataagtttgttt
ggagatagagagtttctgaccatggacagtctttttaaagctcatcccaatggatgcttg
gttatcatatcaagaacactggattcgtctcaagggttgaggattctaagccctttagtt
gatagaggatttaaggttcttgcagtgactccggacttgcctcagttgttcaaggatacg
ccagcagagtcgtggtttgatgatatgaagagtggtgtcaaggatcctggtgaaatttcg
ttggctcaaaacctatctaacttgatcagactagcagttctctacaagtatggtggagtt
tacttggacacggatttcatagttttaaaagatttttcggggttgaggaactcgattggg
gcacaaagtatgaacaaatcagggaactggacaaggctaaacaatgcagttctaatcttt
gacaagaatcatccacttctgtacaagttcatagaggaatttgcattaagttttaatgga
aacatatgggggcataatggaccatacctagtctcaagagtagtttccaatttgacatca
gctcaagactacaattttactattttgcctcctatggcattttatcctgtttactggagt
cgtgttgatggattcttcatggggcctgaacaggttcgtcgaagatggatcgaacacaag
ctacaacagctcacagacatgacctatggaatgcacctgtggaacaaacaaagcagcaga
cttacaattgaacaaggaagcatagtgcagaaattaatctcagagcattgtactatatgc
aagcatgaatatacttcttag

DBGET integrated database retrieval system