KEGG   Daucus carota (carrot): 108198628Help
Entry
108198628         CDS       T05350                                 

Definition
(RefSeq) 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
dcr  Daucus carota (carrot)
Pathway
dcr00906  Carotenoid biosynthesis
dcr01100  Metabolic pathways
dcr01110  Biosynthesis of secondary metabolites
Module
dcr_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    108198628
Enzymes [BR:dcr01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     108198628
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 108198628
NCBI-ProteinID: XP_017221885
Position
8
AA seq 580 aa AA seqDB search
MSLSLAATSNFYKLQIMSVPSSSSTIKPCFNKACWIKSSLQSPLQLPEQPHCSHNITKDD
SGSSPSTPRRWNLLQKAAATALDMAEKALLSLEAKQTLSKTADPAVQMAGNFAPVPESSV
RQNLQVIGTIPEDISGVYVRNGANPYFEPVSGHHLFDGDGMVHAVMINGNSVSYACRFTK
TERLVQERDLGRPIFPKAIGELHGHSGIARLALFYARGLFGLVDPSHGIGVANAGLVYFN
GRLLAMSEDDLPYQIQVSESGDLETIGRYDFESQLKSSMIAHPKVDPVSGELFALSYDVI
KKPYLKYFRFSKDGEKSRDVEIPLDIPAMTHDFVITENFVVIPDQQVVFKLQEMLKGGSP
VTYDKNKMSRFGILSKYAEDSSDIIWIDSPENFCFHLWNAWEEPDSDEIVIIGSCMTPPD
SIFNESDEGLESVLSEIRLNLRTRKSTCHAIMSPSEQVNIEVGMVNRKKLGRKTEFAYLA
IAEPWPKVSGLAKVNLFTGEAQKYYYGDERYGGEPFFLPSNSDREDEGHIMAFVHDEKTW
QSELQIINSANMELEATVKLPSRVPYGFHGTFISSEELVQ
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgtctttatcattagctgcaacttcgaatttttataaacttcaaatcatgagcgttcct
tcctcatctagtacaatcaagccttgttttaataaagcttgctggattaaatcttcccta
cagtctcctcttcaattacccgaacaacctcattgctcacataatatcacgaaagatgac
tcgggttcgagtccttccacaccacgaagatggaatttactacaaaaggcggcagccacg
gctttagacatggcggagaaggccttgctctcgcttgaagccaaacaaacactctccaag
acagctgatccagcagtacaaatggccggcaactttgctccggtgcccgaatcatctgtc
cgacaaaatttacaagttatagggaccattcctgaagatatatccggcgtctacgtgaga
aacggtgcaaatccatatttcgagcctgtttccggacaccacttatttgatggtgacgga
atggttcatgcggttatgataaacggcaattcggtgagttatgcatgtaggtttacgaaa
actgaaaggcttgttcaagaacgagatttgggtagaccgattttccctaaggctatcggt
gagcttcatggacactcgggtatagctcgattggcactcttttatgcccgagggctattc
ggcttggttgatccgagccatggaattggtgtagctaatgctggccttgtttattttaat
ggccgacttttggccatgtcggaagatgatcttccctatcaaattcaagtcagcgagagt
ggtgatttagagactattggtcgatatgacttcgagtcgcaattgaagtcttcgatgata
gctcatccgaaagttgaccccgtgtcgggtgagctatttgctttgagttatgatgttatt
aagaaaccctacttgaagtattttcgattttctaaagatggtgagaaatctcgtgatgtt
gagatccccttggatatccctgcaatgacgcatgatttcgtgataacagagaattttgtt
gtgattcctgatcaacaagtggtgttcaagctacaagaaatgttgaagggaggttccccg
gttacgtatgacaaaaacaagatgtctaggtttggaattttatccaaatatgccgaagat
tcgtctgatattatttggattgattcacccgagaatttttgtttccatttatggaatgca
tgggaagaaccggattcggatgaaattgtcattatcggctcatgcatgacaccacccgac
tccatattcaatgaatccgatgagggtctcgaaagtgttctttctgaaattcggctaaat
ttaaggacgagaaaatctacatgtcacgccataatgagtccatcagagcaagtgaatatt
gaggttggaatggtgaatcggaagaaactaggccgaaaaacggagtttgcctacttggcc
attgccgaaccgtggcctaaagtatctggtctggccaaagtgaacttatttactggagag
gcacaaaaatattattatggcgacgaaaggtatggcggggagccattctttttgccttca
aactccgacagagaagacgagggacacattatggcattcgttcacgacgaaaagacatgg
caatcagagcttcaaatcatcaactctgcgaacatggaattagaagccacagttaagctt
ccgtcgagggtgccttatggattccacggaacattcatcagctccgaggaattggtacaa
taa

DBGET integrated database retrieval system