KEGG   Daucus carota (carrot): 108199544Help
Entry
108199544         CDS       T05350                                 

Definition
(RefSeq) probable methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
dcr  Daucus carota (carrot)
Pathway
dcr00450  Selenocompound metabolism
dcr00970  Aminoacyl-tRNA biosynthesis
dcr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    108199544
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    108199544
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dcr01007]
    108199544
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dcr03016]
    108199544
Enzymes [BR:dcr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     108199544
Amino acid related enzymes [BR:dcr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   108199544
Transfer RNA biogenesis [BR:dcr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    108199544
 Prokaryotic type
   Other AARSs
    108199544
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 Hormone_recep SOGA
Motif
Other DBs
NCBI-GeneID: 108199544
NCBI-ProteinID: XP_017222896
Position
8
AA seq 809 aa AA seqDB search
MSNLSAAAAAGDDRKPIKLPISGKRNVLITSALPYVNNVPHLGNIIGCVLSADVFARYCR
LRGYNAIYVCGTDEYGTATETKALEENCTPKEICDKYHAIHKKVYEWFDIKFDEFGRTST
PQQTEVCQAIFTKLMENNWLSENTMQQLYCDTCKRFLADRLVEGSCPTQGCNYDSARGDQ
CEKCGKLLNPTELIDPKCKVCQNTPRIRDTDHLFLELPLLKDKLVEYINNMSVAGGWTQN
AIQATNAWLKEGLRQRCITRDLKWGVPVPHEKYKDKVFYVWFDAPIGYVSITSCYTAEWE
KWWKNPENVELYQFMGKDNVPFHTVMFPSTLLGTGENWTLMKTISVTEYLNYEAGKFSKS
KGIGVFGNDAKDTNIPVEVWRYYLLTNRPEVSDTLFTWADLQAKLNGELLNNLGNFVNRV
LSFIAKDQASGYGSIIPDAPGAESHLLTKNLGDKVGSCVEQYIEAMEKVKLKQGLKLAMS
ISGEGNAYLQESQFWKLYKEDKASCSIVLRTAAGLVYLLACLLEPFMPSFSAEVLKQLNM
PLETQVTLTDEKGDIERSKRPWELLPAGHKIGTPAPLFKELSDKDVESFRQKFAGSQADR
IVKAEAEAKQITEQLKKAKVSDGNVKKERTKKSASENKPKAAEQEISISRLDIRVGLITK
VQKHPDADSLYVEEIDVGEGQPRTVVSGLVKFIPLEEMQNRKVCVLCNLKPATMRGIKSH
AMVLAVSNADHSKVELVDPPQSAPVGERLTFSGFEGDPDDVLNPKKKVWETIQPDLHTNK
ELIACYKDLPFTTSVGVCKVSSISDGSIR
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatctctccgccgccgccgctgccggcgatgaccggaaaccgatcaagctcccg
atttccggcaagcgcaacgttctcattactagcgccctgccgtacgtcaataacgtccct
catctcggcaatatcatcggatgtgtgttgagtgcggatgtgtttgctcggtactgtcgt
ctacgaggatacaatgcgatatacgtgtgtggaacggatgagtacgggacagctactgag
acgaaggcgctggaggagaactgcacgcctaaagagatttgtgacaaataccacgctatt
cacaaaaaggtgtacgaatggtttgacataaagtttgatgaatttggacgcacttcaacc
ccacagcagactgaggtctgccaagccatatttacaaaactgatggaaaacaattggctt
tcagaaaacacaatgcagcagctttactgtgatacatgcaaaaggtttttggctgaccga
cttgtagagggttcctgcccgacgcaaggctgcaactatgattctgcgcgaggagatcaa
tgtgaaaagtgtggcaaacttttaaaccctacagaactaatagacccaaaatgcaaggtc
tgtcaaaacacaccacgcatccgtgacacagatcacttgtttctcgaactccccttacta
aaggataaattagtagagtacattaacaatatgtcggtggctggagggtggactcaaaat
gctattcaagcaacaaatgcatggctaaaggaaggtctaagacaacggtgtataaccaga
gatttgaagtggggggttcctgttccacatgagaaatacaaggacaaggtattctatgtt
tggtttgacgctccaattggatatgtttctattacttcctgttacacggcagagtgggaa
aagtggtggaagaaccctgagaatgtagaattgtatcaatttatgggcaaggataatgta
ccttttcatactgttatgtttccatccacacttcttggaactggtgaaaattggaccctg
atgaaaactatcagcgttactgaatacttgaactatgaagcagggaagttctcaaagagt
aagggtataggagtttttggaaatgatgcaaaagacactaacattcctgtagaagtgtgg
agatattatttgctaactaatagaccagaggtatcagacacgttgtttacatgggcggac
ttgcaagcaaagttaaatggtgaattgttaaataatcttggaaatttcgtcaatcgtgtg
ttgagcttcatcgccaaagatcaagcttcaggatatggctccatcatccctgatgcacca
ggtgctgaatcacacctccttacaaaaaatttgggtgataaagttggtagctgtgtggag
caatatatagaagctatggagaaggtcaagctaaagcagggactgaagcttgcaatgagc
atttctggtgagggaaatgcatatctgcaagaaagccaattctggaagctttacaaagaa
gacaaggcttcctgttctatagttttaaggactgcagcaggactggtctatctgcttgct
tgcctgctagaaccatttatgccatccttctctgctgaggtacttaaacagctgaacatg
cctcttgaaacacaagttacacttacagacgaaaaaggagatattgagaggtctaaaaga
ccatgggagttgttacctgctggtcacaagattggaactcctgctccattatttaaggag
ctgtcggacaaggatgtggagtctttcaggcaaaagtttgctggaagccaagctgataga
attgtgaaagcagaagctgaagcaaaacaaattactgaacagctgaaaaaggcgaaagta
tcagatggaaatgtaaaaaaagaacgaaccaaaaaatctgcttccgaaaataaacccaag
gcagctgaacaagaaatctccataagtaggcttgatatccgtgttggtctcatcacaaag
gttcagaagcatcctgatgccgattccttatatgttgaagaaattgatgtgggcgagggt
caacctcgaacagttgtgagcggacttgttaaatttattcctcttgaagaaatgcagaac
cgtaaggtatgtgttctttgcaatttgaagcctgcaaccatgaggggtatcaagtcacat
gctatggttcttgctgtttcaaatgctgatcactctaaggttgaattggttgatccacca
caatctgcacctgttggagaaagattgaccttttctggctttgaaggcgaccctgatgac
gttcttaaccctaagaaaaaggtctgggaaaccattcagcctgacttgcacactaacaag
gaactgatagcctgctacaaagatttgcctttcactacatcagtcggagtttgcaaggtc
tcgtcaatatctgatggatcaatacgatag

DBGET integrated database retrieval system