KEGG   Daucus carota (carrot): 108199816Help
Entry
108199816         CDS       T05350                                 

Definition
(RefSeq) alcohol dehydrogenase 1
  KO
K18857  alcohol dehydrogenase class-P [EC:1.1.1.1]
Organism
dcr  Daucus carota (carrot)
Pathway
dcr00010  Glycolysis / Gluconeogenesis
dcr00071  Fatty acid degradation
dcr00350  Tyrosine metabolism
dcr00592  alpha-Linolenic acid metabolism
dcr01100  Metabolic pathways
dcr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108199816
  09103 Lipid metabolism
   00071 Fatty acid degradation
    108199816
   00592 alpha-Linolenic acid metabolism
    108199816
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    108199816
Enzymes [BR:dcr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     108199816
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C TrkA_N UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 108199816
NCBI-ProteinID: XP_017223294
UniProt: A0A175YMY6
Position
8
AA seq 378 aa AA seqDB search
MASTAGQVIRCKAAVAWEAGKPLVIEEVEVAPPQKLEVRIKILFTSLCHTDIYFWEAKGQ
NPVFPRIFGHEAGGIVESVGEGVTDLAPGDHVLPVFTGECKECAHCKSEESNMCDLLRIN
TDRGVMLNDGKSRFSINGKPILHFVGTSTFSEYTVIHVGCVAKINPLAPLDKVCVLSCGI
STGLGSTLNVAKPKKGSTVAVFGLGAVGLAAAEGARIAGASRIIGIDLNPNRFESAKKFG
VTEFVNPKDHQKPVQEVIAEMTNGGVDRSIECTGHVDAMISAFECVHDGWGVAVLVGVPH
KDAVFKTHPMNLLNERTLKGSFFGNYKPRTDLPSVVEKYMNKELELEKFITHEVPFAEIN
KAFDLMLKGEGLRCIIRM
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcactgctggtcaagtcattcgctgcaaagctgctgtagcatgggaagcaggg
aaaccacttgtgatcgaggaggttgaggttgcccctcctcagaaactcgaggttcggatc
aagatcctcttcacttccctctgccacactgatatttacttctgggaagccaagggacag
aaccctgttttccctcgaatttttggacatgaagcagggggtattgtggagagtgtcgga
gagggagtaacggatttggcaccaggtgatcatgttctccccgtcttcaccggagaatgc
aaggaatgtgcacattgcaaatcagaagaaagcaatatgtgtgatctccttaggatcaac
accgacagaggtgttatgcttaatgatggaaagtcgcgcttttcaatcaatggcaagccc
atcctacattttgtaggaacatccacctttagcgaatacactgtcatacatgttggttgt
gttgcaaagataaaccctcttgctcctttggacaaagtttgtgtccttagctgtggaatt
tcaactggattgggttcgactctaaatgttgcgaaacctaagaagggctcaacagtggct
gtctttggattgggagctgttggccttgctgcggcggaaggagctagaattgctggggct
tctagaattattggtattgatctgaatccaaacagatttgaatctgcaaagaagtttggt
gtgacagagtttgtgaatccaaaagaccaccaaaaaccagttcaagaggtgattgctgaa
atgactaatggaggagtggacagaagtatcgagtgtaccggacatgttgatgccatgatt
tcagcctttgaatgtgtacatgatggttggggtgtcgctgtgcttgttggagttccacat
aaagatgctgtctttaagactcaccccatgaatttgttgaatgaaaggaccctcaagggt
agtttctttggaaactacaaacctcgtactgaccttccatccgtggtcgaaaaatacatg
aacaaggaactcgaactggagaagtttattactcatgaagtcccatttgctgaaatcaac
aaggcctttgatctgatgctgaaaggggaaggcctccgctgcattatccgaatgtaa

DBGET integrated database retrieval system