KEGG   Daucus carota (carrot): 108199957Help
Entry
108199957         CDS       T05350                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase-like
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
dcr  Daucus carota (carrot)
Pathway
dcr00511  Other glycan degradation
dcr00600  Sphingolipid metabolism
dcr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    108199957
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    108199957
Enzymes [BR:dcr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     108199957
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N Bac_rhamnosid6H Trehalase
Motif
Other DBs
NCBI-GeneID: 108199957
NCBI-ProteinID: XP_017223478
Position
8
AA seq 965 aa AA seqDB search
MVSGNIFQYKKSSWPPQDYVNRATLELLDSDSAAPPKQAWRRKLNSHASILKEFSVTFME
AIKMVRLGIRLWSYVREEASQGRKAPIDPFTRESCKPSASQGVPLGGMGSGSISRGFRGE
FKNFQIVPGTCDTSPIMANQFSIFISREGGSKKYASVLSPGKHENLGESSYEGLSSWGWN
LTGQHSTYHALFPRAWTVYDGEPDPELKVSCRQISPFIPHNYQDSSLPTTVFVYTLVNTG
KERAKVSLLFTWANSIGGISHLSGDHVNEPFIAEDGVSGVLLHHKTSKGNHPVTFAVAAC
ETQNVSVTVLPSFGLSEGSYPTAKAMWGKMAQDGYFDRDGFDAGPSMPSSPGETRCAAIS
ASAWIEPHGKCTMAFALAWSSPKVKFNKGKSYHRRYTRYYGTSERAASNLVHDALTNYKR
WEEDIERWQNPILNDDRLPEWYKFTLFNELYFLVSGGTVWIDSALPDAHFSSNHPQTRKT
MKYRSDAVVENIKSSGSDSNVENGSTGDVESSHTGFSDEDGSVISQGEQKDNYIQYPSHE
NNSDDVGKFLYLEGVEYIMWCTYDVHFYASFALLELFPKIELSIQREFAKAVLFEDKRKV
KFLSEGNWGIRKVKGAIPHDLGTHDPWHEMNAYNIHDTSKWKDLNPKFVLQVYRDFAATG
DLSFGTDVWPAVCAAMEYMEQFDRDNDCLIENDGFPDQTYDAWTVHGVSAYCGCLWLAAL
QATAAMALQLGDNISAERYKRKFLKAKSVLEAKLWNGSYFNYDSGSSGNSKSIQADQLAG
QWYTASSALPNLFDDLKIQSSLQKIYDFNVMKVRGGRMGAVNGMHPNGKVDDCCMQSREV
WTGVTYAVAATMIYAGMEEQAFTTAEGIFYAGWSEDGFGYAFQTPEGWTMDGHFRSLTYM
RPLSIWGMQWALSLPKVILDAPRVNIMDRIQLSPQSARSHHAENGVRKIAEKAKCFSNSM
FRCAC
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggttagtggaaatatatttcaatacaagaagagttcatggcctcctcaggattacgta
aacagggcaacactagaactacttgattctgacagtgctgccccaccaaaacaagcatgg
agaaggaaattaaacagccatgctagtattcttaaagaattcagtgttacatttatggag
gcaataaaaatggttcgacttggtatacgactgtggtcatatgtaagggaggaagcctcc
cagggaaggaaagcacctattgatccatttacccgtgaaagttgcaagccgtcagcatcc
caaggggttcctcttggagggatgggaagtggtagcatatctagaggttttagaggtgaa
ttcaaaaattttcaaattgttcctggcacctgtgatacttctcctatcatggccaatcag
ttctctatttttatatcccgggaaggtggaagtaaaaagtacgcgtctgtcttatcccca
gggaaacatgaaaatttaggggaatcttcatatgagggtctatcatcatggggttggaat
ttaactggtcagcattcaacatatcatgcactatttccaagggcatggacagtatatgac
ggtgagccagatccagaactaaaagtatcgtgtcgccaaatatcgccgtttataccacat
aattatcaggacagcagtcttcctacgactgtttttgtttacacgctggtaaacactggg
aaggaaagggcaaaagtcagccttctttttacctgggcgaattcaattggaggaatctct
cacctatctggagatcatgtaaatgagcctttcatagctgaagatggagtgtctggtgta
cttctacatcacaaaacttcaaaagggaaccatcctgttacattcgccgttgctgcatgt
gaaactcagaacgtcagtgtaacggttttaccctcgtttggcctgtctgagggaagttat
cctacagcaaaagccatgtgggggaaaatggcacaggatgggtactttgatagggatggc
tttgatgctggaccaagcatgccttcatcaccaggagagacacgttgcgccgcgatttct
gcttcagcatggattgagccacatgggaagtgcaccatggcatttgctcttgcatggtca
tctccaaaagttaaattcaacaaaggaaaatcgtatcataggaggtacactagatactac
ggtacatctgaaagggcagcatcgaatttagtccatgatgcgctaacaaattataagcga
tgggaagaagacatcgagagatggcaaaatcctatcctcaacgatgataggctaccggaa
tggtacaaatttacattatttaatgaactctacttcttggtttctggtgggacagtttgg
attgactctgcattgccagatgcacattttagctcaaatcatcctcaaacaaggaaaaca
atgaagtacagaagtgatgcagttgtagaaaatataaagagttctggttctgacagtaat
gttgagaatggttcgacaggtgatgttgaaagctctcatacaggattttctgatgaagat
ggttcagtaatttctcagggagaacagaaagataactacattcagtacccttctcatgag
aataacagtgatgatgttggtaaattcttgtatttagaaggtgtggagtatattatgtgg
tgtacatatgatgttcatttttatgcatcttttgccctccttgagctgttccctaaaatt
gaattgagtattcagcgggaatttgcaaaagccgtgctttttgaagataaaagaaaagtg
aaatttctgtccgagggaaactggggaatccgtaaagtcaaaggagcaattcctcatgat
cttggaactcatgacccctggcatgaaatgaatgcatacaacatacacgatactagtaag
tggaaggatctgaacccaaaatttgtgcttcaggtctatagagactttgctgcaacaggg
gatttgtcatttggaactgatgtatggcctgctgtttgtgctgcaatggagtatatggaa
cagtttgatcgggacaatgattgtcttatagagaatgatggatttccagaccagacatat
gatgcttggacagttcatggtgtaagtgcttactgtggctgtttatggcttgctgcactt
caagctacggcagcaatggccttgcaactgggtgacaacatttctgccgaaagatataaa
agaaaattcttgaaggcaaagtccgtattggaagcaaaactatggaatggttcatatttt
aactacgacagtgggtcaagtggtaatagtaaatcaatccaagctgaccaattggctgga
caatggtatacagcatcttcagcattgccaaatctttttgatgatttaaagatccaaagc
tcccttcaaaaaatctatgatttcaatgttatgaaagtcagaggagggagaatgggtgct
gtcaatgggatgcatcctaatggaaaggtggatgattgttgcatgcaatctcgtgaagta
tggacgggggtcacatacgctgtggcagccaccatgatttatgctggtatggaagaacag
gctttcaccacagcagaaggtatattttacgcaggctggtcagaggatggatttggatac
gccttccaaactccagagggatggactatggacgggcacttcagatctctaacttacatg
cggccactttccatatggggaatgcagtgggctttatccttacctaaagtgatccttgat
gcccctcgcgtcaatataatggacagaatccaactctctcctcagagtgctagatctcat
catgcagagaatggtgttagaaagattgctgagaaagcaaagtgctttagcaattcaatg
ttccgctgtgcatgctga

DBGET integrated database retrieval system