KEGG   Daucus carota (carrot): 108204503Help
Entry
108204503         CDS       T05350                                 

Definition
(RefSeq) L-type lectin-domain containing receptor kinase IX.1-like
Organism
dcr  Daucus carota (carrot)
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_legB Pkinase Pkinase_Tyr Pkinase_fungal Kinase-like Protocadherin APH
Motif
Other DBs
NCBI-GeneID: 108204503
NCBI-ProteinID: XP_017229466
Position
1
AA seq 649 aa AA seqDB search
MLLCNFQFKIHYYTFLIIFHYSIIISCGAQLSFNYSTFSPNTKGINYDGNATASNPGIQL
TLNQNDRGLNQSSGLATYFEAMHLWDNKSGSIADFSSNFSFKIDSRGLSNYSDGMTFFLA
PVGFTMPRKQQGAGLGLVYVDQNFNSSLIQFVAVEFDTHANLDYPVDPPYDHVGIDISSM
TSVKTMRWRNRIPDGFMNEAWISYSSSAKNLTVSFTSFVDSEPSIESLWYEVDLSKCLPE
RVVFGFSAATGRLYSEIHTIHSWNFSSNIQINEDNTTPPETAPKVTISLRPKKKNSEKVV
VGLVAGASACILVLAVAFLWFKSKKKKKAVNNEEKDVSMVPYEFENETGPKKYSYETLST
STKNFAEAEKIGQGGFGGVYKGFLSQLNSYVAVKRISKGSKQGIKEYASEVKIISRVRHR
NLVQLIGWCHEEKELLLVYEFMPNGSLDSHLFRDNVFLTWMMRYNIARGLASALLYLHEE
WEQCVLHRDIKSSNVMLDSDFNAKLGDFGLARLVDHGKEIETTLIAGTMGYMAPEYVMTG
RASKETDVYSFGIVALEIASGRHPINSKGKQGEVLLVEYIWLLYGQEKILEAADPKLSSD
FDDKELTRLLIVGLWCAHPDHKLRPSIRQAIQVLNFEVPLPRLSSTMPA
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgctgttatgcaattttcagttcaagattcattactatactttcttgatcatttttcac
tactctatcataatctcatgtggtgctcagctttcctttaactactctacgtttagtcca
aacacgaaggggataaactatgatggtaatgccacagcctctaatcctggaatccagtta
accctcaaccagaatgacagaggtttgaatcagagttctggccttgccacatattttgag
gcaatgcatctgtgggacaacaaatccgggagcatcgcagatttctcttccaatttttca
ttcaaaattgactcacgaggtctcagtaattattcggatgggatgacttttttccttgca
ccagttggtttcaccatgcccaggaagcagcaaggtgctggcctcggccttgtatatgtt
gaccagaatttcaactcgtcacttattcagtttgtagcagtggagttcgacactcatgca
aatctcgactaccctgtagaccctccttatgatcatgtaggtatagacattagctcaatg
acatctgtaaaaactatgagatggagaaatcgtattccagatggatttatgaatgaagct
tggatcagttatagttcttctgccaagaacttgactgtttccttcacatctttcgtcgat
agtgagccttccatagagagtctttggtatgaagttgatctgagcaagtgtttacctgaa
agagttgtttttggcttttcagctgcaacaggacgtctttattcggaaatacatacaatt
cattcttggaattttagctcaaacatacagatcaatgaggacaatacaacgcctccagaa
acggctcctaaggtaactataagcttaaggccaaaaaagaaaaacagcgaaaaagtagta
gtggggcttgttgcaggtgcctcagcctgcatattggtcttagcggtggcttttctttgg
ttcaagtcaaaaaagaagaaaaaagcagttaacaatgaagaaaaggatgtttccatggtt
ccttatgaatttgaaaatgagactggaccaaagaagtattcatacgagacgctgtctaca
tcgacaaagaactttgcagaagcagaaaagattggacaagggggttttggaggggtttat
aagggtttcttgagtcaactaaactcctatgttgctgtgaaacggatatcaaagggatct
aaacagggaataaaggagtatgcatctgaagtaaagattattagtcgagtaagacacagg
aatctagtgcagctgatcggttggtgtcatgaagaaaaggaacttctacttgtttacgag
tttatgcctaatggtagcttagattcccatcttttcagggacaacgtgttcttgacatgg
atgatgaggtataatattgctcgtggattggcatcagcattgctctatttacatgaggaa
tgggaacaatgtgttctccatagggatatcaaatcaagtaatgttatgttggactcagat
ttcaatgcaaagcttggagatttcggcttagccagacttgtagatcatggaaaggaaata
gaaacaacgcttatagcagggacaatgggctacatggcaccagagtacgtcatgacaggc
agagccagcaaggaaacagacgtttacagcttcgggattgttgccttagaaatagcttca
gggagacatcctatcaactctaaaggtaaacaaggcgaggttttactagttgagtatata
tggctgctttatgggcaagaaaagattcttgaagctgctgatccaaaactttcttcagac
ttcgatgacaaagaattgacacgcttgttgattgtcgggctatggtgtgctcaccctgat
cacaagctccgaccttcaataaggcaagcgattcaagtgctgaattttgaagttccactt
ccccgactttcatccacgatgccagcataa

DBGET integrated database retrieval system