KEGG   Daucus carota (carrot): 108205977Help
Entry
108205977         CDS       T05350                                 

Definition
(RefSeq) putative receptor-like protein kinase At4g00960 isoform X1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
dcr  Daucus carota (carrot)
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dcr01001]
    108205977
Enzymes [BR:dcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108205977
Protein kinases [BR:dcr01001]
 Serine/threonine kinases: TKL group
  IRAK family
   108205977
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Stress-antifung DUF3403 Haspin_kinase Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 108205977
NCBI-ProteinID: XP_017231604
Position
2
AA seq 641 aa AA seqDB search
MKFSIPFLYLAINVIGITFGQPPDFIYYSCGSDAGDSTYMTNLNNVLDSISSNFVTSRFY
NFSSGQNLKIAHGIGLCEGNLESDTCRSCLANSAMKLRQLCSNRKEAVGWYEKCMLRYSN
NSIIHIPENKPDYCLRSAVANSGDHSQFNSAVEDHMAILREQAARSSSKFANDSMTFADN
VKIYGLVQCTPDLTVQQCNECLDNVLGVVSRCLQGNFSGKAATPSCNIRYETAVASPHNS
GINIIKIIAVTAASLAGASLVGGFCCVYCRRRKLREGREAKEMRENYQDIQLLDLTGETL
ADEQDVPFIPLAVIRAATQEFAQENKLGQGGFGPVYKGTLLDGKEIAVKRLSRNSGQGIK
EFKTEVSLIAKLQHKNLVRLLGCCMEGKEMLLVYDYMPNGSLEATLFDSVSEARLDWKMR
HRIIKGIARGLLYLHEDSRLKIIHRDLKCSNVLLDNELNPKISDFGMARMFNTNQSEAIT
RRVVGTFGYMAPEYAMQGTISVKSDVFSFGVLLLEIISGKKTSRFHLSEHGQSLLTFAWK
LWSNNHELELMDPLLEETYVENDVLRCIHIALLCVQEDPAYRPTMSEVVFMLENDIVQLP
EATEPAFFLGRRTTQPAPLRIVPKDVGSSINEITFSALSPR
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttagcataccatttctgtaccttgctataaatgtcatcggtataacgtttgga
cagccgccagattttatctactactcttgtggcagtgacgcaggtgacagtacttacatg
actaacctcaacaatgttcttgattcgatctcctccaattttgttacatcaagattttac
aacttctcttctggacaaaatctgaagattgcacatgggatcggcctctgtgagggcaat
ttagaatcagacacgtgtcgttcatgtctggctaactcggccatgaaactaagacagctc
tgctctaatcgtaaagaggctgttggatggtatgaaaaatgtatgctgaggtactctaat
aactcaataattcatattccagagaacaaaccagattattgtttacgtagcgcagttgca
aattctggggatcacagtcaatttaacagtgcagtggaagatcatatggcaattctgcga
gaacaagcagctagaagtagttcaaaatttgctaacgacagcatgacttttgcagacaat
gtaaagatatatgggctggtgcagtgtactccggatttgacagtgcaacaatgcaatgaa
tgtttggacaatgttttaggagttgtttccagatgtttacaagggaattttagtggaaaa
gctgcaacacctagctgcaacattagatatgagactgcagttgcttcgccacataactca
gggataaatataataaagataattgcagtcactgcagcgtctttagcaggagcttcactt
gtaggaggattttgttgtgtttattgtcgacgaagaaagttaagagagggccgagaggcc
aaagaaatgagagagaattaccaagacatccagctacttgatttgactggagagacgctg
gccgatgaacaagatgtccctttcatcccgctagctgttatacgtgcagctactcaagaa
ttcgctcaggaaaacaagcttggacaagggggatttggtccagtgtacaagggaacattg
cttgatgggaaggaaattgcagtaaagagactttccaggaattctggtcaaggaataaaa
gagtttaagacagaagtcagtttgattgctaagttacagcacaagaatcttgtcagacta
ttgggctgctgcatggaggggaaagaaatgcttcttgtctatgattacatgcccaatgga
agcttggaagcaaccctcttcgattcagttagcgaggcacgcctagattggaagatgcga
cacagaatcatcaaagggattgctagaggcttgctgtatttacatgaggattctcgtctt
aagatcattcacagagatctcaaatgtagtaacgttctgcttgataacgaattgaaccca
aagatatccgactttggcatggcaagaatgtttaataccaatcaaagtgaagctatcaca
agaagagtggtgggaacattcgggtacatggctcctgagtatgctatgcaaggaacaatt
tcagtaaaatcagatgtattcagttttggagtcttacttctggaaataattagtggaaag
aagacgagccgctttcatctatcggaacatggtcaaagcctcctcactttcgcatggaaa
ttatggagcaataaccatgagctggagctgatggacccattattagaggaaacatacgtg
gaaaacgatgtgttgaggtgcattcatatcgctttgttatgcgtccaagaagatcctgca
tatagacctacaatgtcagaagtagtttttatgctggaaaatgacattgtgcagcttcct
gaagccacagagcctgcattctttctgggacgacgaactactcaacctgctcctctccga
atcgtccctaaagatgttggttcatctatcaatgagatcactttctcagctctctctcct
aggtga

DBGET integrated database retrieval system