KEGG   Daucus carota (carrot): 108206781Help
Entry
108206781         CDS       T05350                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK9
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
dcr  Daucus carota (carrot)
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dcr01001]
    108206781
   01009 Protein phosphatases and associated proteins [BR:dcr01009]
    108206781
Enzymes [BR:dcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108206781
Protein kinases [BR:dcr01001]
 Serine/threonine kinases: Other
  Wnk family
   108206781
Protein phosphatases and associated proteins [BR:dcr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108206781
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal APH OrfB_Zn_ribbon
Motif
Other DBs
NCBI-GeneID: 108206781
NCBI-ProteinID: XP_017232677
UniProt: A0A161X489
Position
2
AA seq 591 aa AA seqDB search
MNDSEENHSEFVEVDPSGRYGRYDELLGKGASKSVYRAFDQYEGIEVAWNQVKLFNFLNS
SNELERLYSEINLLKSLKHQNIMKLFASWVDTRKRNINFVTEMFTSGTLRQYRHKHKKVN
MRAVKNWCRQILRGLLYLHSQNPPVIHRDLKCDNIFVNGNQGQIKIGDLGLAAVLQKSEE
AHCVGTPEFMAPEVYQEEYNELADIYSFGMCILEMVTFEYPYSECTHSAQIYKKVISGKK
PDALNKVKDPEVRQFIEKCLADVSSRLSARELLRDPFLQTEACETNFVAIECHTELNYAD
LFISNPQPGHKGSSFSNCSFNEYSIPSSVQNGSSYELHDSEQNDIHLFEHNDDELEEHLS
QLDISIKGKKKSDGNIFLRLRILDKEARIRNIYFPFDVESDTALSVATEMVGELDLKDQD
VTKIAEMIDGEMVTLVPQWKTGPGFEETHHFDSSNICHNCASTHTSIGSYIQMKCEKGCG
AKHGRFEEYTFNADNHFANPVLSIQSNDFSREYYWEQHGSVECSEVGSGDGHFVGEDGNL
VARQSNLQDESKRFSKLLSGAALSSSSCDEVSDDYECEITKKGDASEQHNQ
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattcagaagagaatcattcagagttcgtagaagttgatcccagtggtagatat
gggagatatgatgagcttttgggcaaaggagcttctaagagtgtatatagagcgtttgat
caatacgaagggattgaagttgcttggaaccaagtaaagctttttaattttctgaatagt
tcgaatgagcttgagagattgtatagtgaaattaatctgctcaaaagcttgaagcaccag
aacatcatgaaattgttcgcttcttgggttgatacaagaaagaggaatattaattttgtg
actgagatgttcacctctggaactctaagacaatatcggcataaacacaagaaggtaaac
atgagagcagtgaagaattggtgcagacagatattgagaggacttctctatcttcacagt
caaaatcctcctgttattcatcgagatctcaagtgtgacaatatctttgtgaatggaaat
caaggccaaataaaaattggtgacttaggcttagcggcggtccttcaaaaatcagaagag
gctcattgtgttgggaccccagaattcatggctccagaagtgtatcaagaggaatataat
gaattagctgacatttattcatttgggatgtgcatactggaaatggttacctttgagtat
ccctatagtgaatgcactcattctgcccaaatttataagaaagttatttctgggaaaaaa
cctgatgctttgaacaaagttaaagatccagaagtacgtcaatttattgagaaatgtttg
gctgacgtatcctcaaggctctcggcaagggaacttctaagggacccatttctccagacg
gaagcttgtgaaacaaattttgtggcaatagaatgccacacagagttgaattatgctgat
ctatttattagcaatcctcaaccaggccataaaggcagctcatttagtaattgctccttt
aacgagtactctattccttcatctgttcaaaatggatcgagttatgagctacatgacagt
gagcaaaatgatattcacctatttgagcataatgatgatgaactggaggaacacctttca
caacttgatatctctatcaaagggaagaagaaaagtgacggtaatatcttcttgagactt
agaattttagacaaagaagccaggataaggaacatctattttccattcgacgttgagagt
gatactgcacttagtgttgcaactgaaatggttggagaactggatttaaaagaccaagat
gtaactaaaatagctgaaatgatagatggggaaatggttactttggtaccgcaatggaag
acaggaccgggttttgaagaaactcatcattttgacagttctaacatttgtcataattgt
gcttccacccatacctcaattggctcctacatacagatgaagtgcgagaaaggttgtggt
gctaagcatggccgttttgaagagtatacatttaatgctgataatcattttgcaaatcct
gtgttgtctattcaatctaatgatttttctcgtgaatattattgggaacaacatggaagt
gtggaatgcagcgaagtcggctctggagatggccattttgttggagaagatggaaatttg
gtcgccagacaatccaacttgcaggacgagtcaaaacgtttctccaaattactatcaggt
gccgctctttcttcatcttcttgcgacgaggtatctgatgattatgaatgtgaaataaca
aagaaaggagatgcctcagaacaacataatcaatag

DBGET integrated database retrieval system