KEGG   Daucus carota (carrot): 108208254Help
Entry
108208254         CDS       T05350                                 

Definition
(RefSeq) rust resistance kinase Lr10-like
Organism
dcr  Daucus carota (carrot)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase GUB_WAK_bind Pkinase_fungal APH YukC
Motif
Other DBs
NCBI-GeneID: 108208254
NCBI-ProteinID: XP_017234263
Position
2
AA seq 703 aa AA seqDB search
MALRLTEKENNMRRKILPSVSPISTKHSLLFIFIFTIIVSSLSSYCCEAAASPSSCGNIR
NISCPFKLQGDRQKCDSSFFTQELSCRNNRTILYLLPDKLLYYVQSINYDNLSIRIVDPG
VRKNNPSSRPLRSLTEEDLQQSAYRAVFYEDGSISGTGPMLSLSELNQPIAMIECPSPVT
SNRYINTTSPTSSYTSSVFGKDYIYAYAYMVVGFIPISELKVNCRISKLAWVSLRAPSRP
SISSNMSAIHDAMLYGFEIPWSYFYCLKCDATLSGEDSCDTQNRDYHHWACKNYDSHCNV
GHLSSYNLTISCIRKNIHDIVTSRKNQRAIGIYFGVRFFLGLLLLLAVVAYRARRRHLSM
YNTIEDFLQAQNNLMPIRYAYSDIKKMTNNFGDKLGEGGFGTVYKGKLRSGLFVAVKILG
KSSSTGQEFINEVATSGRIHHVNVVELLGFCFEGSKRALIYEFMPNGSLEKYIFCKEGTE
EEIASLSWIKMYDISCKVASGIDYLHRGCDMQILHFDIKPHNILLDKNFNPIISDFGLAK
SYATDDSIVTLTAARGTMGYMAPEMFYKNIGGISYKADVYSFGMLLMEMAGRRKNSNPFV
DHVSQVHFPSWVYNQFSEGKELEMEDVTQEERKLVKKMIIVALWCIQMKPSDRPPMNKVI
EMLEGPVEHLVMPPKPFLYTKEDPAEIKSSSTQSFLKSLQTEE
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atggctctgcgcctaactgaaaaggagaacaatatgagaaggaagattttgccatctgta
tctccaatctccacaaaacactcattgttgttcatattcatttttacaataatagtctct
tctttaagctcatactgctgcgaagctgctgcatctccttcttcttgcggtaatattcga
aacataagctgtcctttcaaactgcaaggtgatcgtcagaaatgcgattcttctttcttc
acccaggagctgtcctgccgcaataatcgtaccatcttatatttgcttccagataagctc
ctatattatgtccagagtataaactatgataatctttcgattaggatcgttgatccaggc
gttcgaaagaataacccttcttctcgtccgcttcgttcgttgacagaagaagacctacag
caatccgcttatcgtgctgtattttacgaggatggcagtatctcaggaaccggaccaatg
ctctccttaagcgagcttaatcagcctattgcaatgatagaatgtccgtctcctgtaact
tctaatcgttacatcaatacaacttcaccaacttcttcgtatacctcttcagtgttcggg
aaggattatatctacgcttatgcttatatggtggttggatttatacctatatccgaattg
aaggttaattgcaggattagcaagttagcttgggtctcactacgagcgccttctagaccc
tcaatttcatccaatatgtctgcaattcacgatgcaatgctttatggatttgaaattccc
tggagttacttctactgcctgaagtgtgatgcaaccctgtccggagaggattcatgtgat
acccaaaatcgcgattatcatcactgggcttgcaaaaattacgactcacactgcaacgtc
ggtcatctaagctcttacaatcttacaatttcgtgcatccgtaaaaatatacatgacatc
gtaacaagccggaaaaatcaaagggccattggaatatattttggtgtaagattcttttta
ggattactactattgctcgctgtggtggcttatagagctagaagaaggcatttatcaatg
tataacaccattgaggattttcttcaagctcaaaacaacttgatgcctataaggtatgcg
tactctgatattaagaagatgaccaataattttggagataaactgggtgaaggaggtttt
ggcaccgtatataaaggaaagcttcgcagtggtctttttgtggcagtaaagatactgggc
aagtcttcatcaactggccaagaattcattaatgaagttgctaccagtggaagaattcat
catgtcaatgtggtggaactccttggcttttgttttgaaggttccaagcgtgctctaatt
tatgagttcatgcctaatggatctttagagaaatacattttctgtaaggaaggaacagaa
gaagaaattgcttccttgagttggataaagatgtacgatatttcctgcaaggtagcaagt
ggaattgactacttacatcgaggttgtgacatgcaaattttgcattttgacatcaaacct
cacaacattctcctcgataagaatttcaatccaattatttcggatttcgggcttgcaaaa
tcatatgccaccgacgatagcattgtgactcttactgcagcaagaggtacaatgggctac
atggctccagaaatgttttacaaaaatattggtggaatttcatacaaagcagatgtttat
agttttggaatgttgctcatggagatggctggtcgaaggaaaaattcaaatccatttgtg
gatcatgttagccaggttcacttcccgtcgtgggtatacaaccaatttagcgaaggtaaa
gagcttgagatggaagatgttacccaggaagaacggaagttggtgaagaagatgataata
gtagcattgtggtgtatacaaatgaaaccgagtgaccgtcctccaatgaacaaagttatt
gaaatgctagaaggacctgttgaacacttggtaatgcctcctaaaccatttttatataca
aaagaagatccggcagagataaagagcagctcaactcaatctttcctcaagtcactgcaa
actgaggaataa

DBGET integrated database retrieval system