KEGG   Daucus carota (carrot): 108209622Help
Entry
108209622         CDS       T05350                                 

Definition
(RefSeq) autophagy-related protein 16-like
  KO
K17890  autophagy-related protein 16-1
Organism
dcr  Daucus carota (carrot)
Pathway
dcr04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    108209622
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dcr04131]
    108209622
   03029 Mitochondrial biogenesis [BR:dcr03029]
    108209622
Membrane trafficking [BR:dcr04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    108209622
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    108209622
Mitochondrial biogenesis [BR:dcr03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    108209622
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 Nup160 eIF2A Cytochrom_D1 DUF5046
Motif
Other DBs
NCBI-GeneID: 108209622
NCBI-ProteinID: XP_017236112
Position
2
AA seq 509 aa AA seqDB search
MLDEEIALDAIKHALRALRKRHLVEEAAHGPAYIALSRPFISQGSEWKEKAESLETELQQ
CYKAQSRLSEQLVVEVAESRASKSLLQDKEDLIASLQNECSQSRDECTRLKELLDEKTQA
VELLTSENQELKAQLEETRVRADTAQAENKMLIDRWMLQKMQDAEKLNEANAVYEDMIDK
LKASSIEQLARQQVDGVVRQSEEGAEYYVESTIPTANKHKISAHQGGCAALVFEYNSNIL
ISGGQDQTIKMWDTSSGSLIRTLHGCLGSVLDLAITHENSSIIAASSSNKLFVWDKDSGR
LRHTLTGHVDKVCAVDVSKFSSRHVASAAYDRTIKIWDLQRGYCTNTIIFPSNCNALSFG
MDGHTICSGHVDGHLRLWDIQTGKLLSEVAAHSLAITSISLARNGNVILTSGRDNVHNLF
DMRTLEVCGTLRASGNRMASNWSRSCISADDNYVAAGSADGSVHVWSISKASIVSTLKEH
NSSVLCCSWSGLGKPLATADRSGTICTWT
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgaagaaatagcattagatgcaatcaaacatgctttgagggctcttcggaaa
cgccatttggttgaagaagcagctcatgggcctgcttacattgctctttctaggcccttt
atatctcagggttcagaatggaaggagaaagcagaaagtcttgaaactgaacttcaacaa
tgttataaagcccaatcccgattatcggaacagcttgttgtggaagttgctgaatctaga
gcttcgaaatcgttactgcaagacaaagaagatttaattgccagtttgcaaaatgaatgt
agtcagtcaagagatgaatgcactcgtctaaaagaacttttagatgaaaagacgcaagct
gtagaactgcttacaagcgagaaccaggaactcaaggctcaacttgaagagacgagggtc
agagctgatactgctcaggctgaaaataaaatgctaattgatcgctggatgttgcaaaag
atgcaggatgctgaaaagcttaatgaggcgaatgctgtttatgaggatatgattgataag
ctcaaggcaagcagtatagaacagctggcgcggcagcaagtggatggtgtggttcgccag
agtgaagaaggtgctgagtattatgtggagtctactattcctactgcaaacaaacacaag
atctctgctcatcagggtggatgtgctgccttggtatttgagtataactctaacatattg
ataagtgggggccaggaccagactattaaaatgtgggacacaagttctggttcactgatc
cgcacactgcatggttgtttgggctctgttcttgatctggcaatcacccacgaaaatagt
tctattattgctgcaagtagctcaaacaagttgtttgtttgggataaagattctggccgg
cttcggcataccctgacaggccatgttgataaagtatgtgctgtagatgtgagtaaattc
tcaagtcgtcatgtcgccagtgctgcctatgaccggacaataaaaatttgggatttgcag
agaggctattgcactaatacgattattttccctagtaactgcaacgcactttcttttggc
atggatggacatactatatgctctggtcatgttgatggacatcttcgattgtgggacatt
cagacaggaaagctacttagtgaagtcgctgcacattcacttgcgattacatcaatatcc
ttagcaagaaatggaaatgtaatattgacaagcggcagagataatgttcataatttgttc
gatatgcgaactttagaggtctgtgggacattaagagcaagcgggaacagaatggcttct
aattggagcaggtcgtgcattagtgcagatgacaattatgtcgcagctggctcagctgat
ggatctgtccatgtctggtcgatatctaaagctagtattgtcagcactctgaaggaacac
aattcatctgttctctgttgttcatggagcggactcggaaaacctctagccacagctgac
aggagtggaacaatctgtacatggacgtga

DBGET integrated database retrieval system