KEGG   Daucus carota (carrot): 108210075Help
Entry
108210075         CDS       T05350                                 

Definition
(RefSeq) glutathione synthetase, chloroplastic-like isoform X1
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
dcr  Daucus carota (carrot)
Pathway
dcr00270  Cysteine and methionine metabolism
dcr00480  Glutathione metabolism
dcr01100  Metabolic pathways
Module
dcr_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    108210075
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108210075
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dcr04147]
    108210075
Enzymes [BR:dcr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     108210075
Exosome [BR:dcr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108210075
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSH_synth_ATP GSH_synthase MOLO1
Motif
Other DBs
NCBI-GeneID: 108210075
NCBI-ProteinID: XP_017236818
UniProt: A0A166D4A1
Position
2
AA seq 540 aa AA seqDB search
MAAIDYNSIGINTDLDRIINLNNSPLCTFPSQNQVKTTNTHLRNSLNLSLKCSKVENFET
HQKILSRIMSDPHRIDQDLLQKLVYDALVWSSLHGLVVGDRNIQRSGVVPGVSMVHAPVA
LLPTSFPESHWKQACELAPIFNELVDRVSLDGKFLQDSLSRTKEVDDFTSRLLDIHSKML
QMNKKEDIRLGLHRSDYMLDEQTKLLLQIELNTISSSFAGLSCVVSELHRSLINTYKKQL
GLDSNKVPINTAVTQFAEALARAWTEYNNPRAAVLFVVQHEERNMYDQHWFSLILNEKHK
ITTVRKTLAEISAQGKLQPDGTLVIDGEAIAVIYFRAGYAPTDYPTESEWRARLLMEQSS
AVKCPSISYHLVGTKKIQQELAKPDVLERFLDNKDDVAKLRKCFAGLWSLEESNIFKDAI
ERPELYVMKPQREGGGNNIYGYDVREALLRLQREETNEDAAYILMQRIFPVVAPTILLRD
GSCHKDSAVSELGIYGAYLRNKEHVLVNEHAGYLMRTKVSSSNEGGVAAGFAVLDSIYLT
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggcagccatcgactacaactcaattggcatcaacactgaccttgatcgcataatcaat
ctaaacaattctccactttgtactttcccttcccaaaatcaagtcaaaaccaccaacact
cacctcagaaattcactcaatttgtctctcaagtgcagtaaagttgaaaactttgagacc
catcaaaagattttgtcaagaatcatgtctgaccctcacagaattgaccaagatttgctg
caaaagttggtctatgatgcacttgtttggagctctcttcatgggcttgttgttggagat
agaaatattcagaggtcaggagtagtgccgggtgtgagtatggttcatgccccagttgct
ttattgccaacatcatttcctgaaagtcactggaaacaggcttgtgagctagcacccata
tttaatgaacttgtcgaccgtgttagtttggatgggaaatttttgcaggattcactttcc
agaacaaaagaagtggatgattttacttccaggctcttggatattcattcaaagatgcta
caaatgaataaaaaagaggatatacgcttggggttacatcggtctgactatatgcttgat
gagcaaacaaaattactactccagatagagcttaatacaatttcgtcttcatttgccggg
ctaagttgtgttgtaagtgagcttcataggagtttaattaatacatacaaaaaacaactt
ggattagattctaataaggttcctattaatactgctgtcactcagttcgctgaagcactg
gccagagcttggacagaatataacaacccaagggctgctgttctgtttgtcgttcaacat
gaagaaaggaacatgtatgaccaacattggttttcattaattctaaatgaaaaacataag
attacaaccgttcgtaagacattagctgaaatcagtgcacaggggaagcttcaaccagat
ggaacccttgttatagatggtgaagccattgcagtaatttatttccgagctgggtatgca
cctacagattatccaacagaatcggaatggagagctagattactgatggagcagtcctct
gcggtgaaatgtccttcgatatcttatcatttggttggcaccaagaaaatacaacaggag
cttgcaaagcctgatgtcctcgaacgctttcttgataacaaagatgacgtcgccaagtta
cggaaatgctttgcaggactatggagtttggaagaatcaaacatattcaaggatgcaatc
gaaagacctgaattatatgttatgaaaccacaaagagaagggggagggaataatatctat
ggatatgatgtgagggaggccctgctaagattgcagagggaagagactaatgaagatgct
gcttatatcctcatgcaaagaattttcccagttgttgctcccacaattctgttgcgcgat
ggcagttgccataaagatagtgcagtatcagagcttggaatttatggggcctacttaagg
aacaaggagcacgtactcgtgaatgaacatgctggttacctgatgcgaacaaaggtttct
tcatcgaacgagggtggcgtagcagcaggatttgcagttttagacagtatatatttgact
tga

DBGET integrated database retrieval system