KEGG   Daucus carota (carrot): 108210743Help
Entry
108210743         CDS       T05350                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dcr  Daucus carota (carrot)
Pathway
dcr00010  Glycolysis / Gluconeogenesis
dcr00562  Inositol phosphate metabolism
dcr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108210743
   00562 Inositol phosphate metabolism
    108210743
Enzymes [BR:dcr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     108210743
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     108210743
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 108210743
NCBI-ProteinID: XP_017237623
UniProt: A0A161WWJ9
Position
3
AA seq 491 aa AA seqDB search
MSLVFLILLLCSALPAHLAFDVRHHLATVTRYDVVKDIVDKSFTPSNIPDQCSPIHLNLL
ARHGTRAPTKKKLRSLEALSLRLETLLQAAKEQKRSLQKIPSWIDGWKSPWKGKVKGGEL
ISEGETELYNLGIRIRESFAELFSDDYHPDVYTIKATQIPRASASAVAFGMGLFSGIGNL
GPGRHRAFAISSESRASDTMLRFHDCCQNYKSFRKSREPGVDKLKRPVLDEVTNSLVLRY
GLNFTRHDTSSLWFLCKQEASLLSKPDQACAMFSPSEVALLEWTDDLESFILKGYGNALN
YRMGVPLLEDVVQSMEQAIKSKEEKQAPGSYEKARLRFAHAETLLPFSCLIGLFLEGSEF
EQIRQEQALQLPLKPPHSRKWRGSIVAPFGGNNMLVLYSCPANNSSKYLVQVLHNEHPVP
LPGCDNSNICPFEVFKERIVAPHLKHDYNQVCNALSEEASEQNFLFFKLKQMFSWLFSPK
NSGKQNHNVEL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttagtatttctcattctgttactatgtagtgcactgccggctcacctagccttt
gatgttcgccatcatctcgctactgtaactaggtacgacgttgtcaaagatattgtagac
aagtcatttacgccgtctaatattcccgatcagtgttctccaattcatctgaatttgctg
gcacggcatggaacccgagcacctacgaagaaaaagttgagatcattggaagctttatct
cttcgattggaaactcttctacaagctgcaaaagaacagaaacgatcattgcagaaaatt
ccatcctggattgatggttggaaatcaccctggaagggcaaggtcaagggtggagaattg
attagtgaaggagaaactgaactttataatctcgggatcagaattagagaaagcttcgct
gagctttttagtgatgattatcacccagatgtatacacaattaaggcaactcagatccct
cgagcgtcagctagtgccgtggcatttggcatgggactttttagcgggataggaaacctt
ggaccaggacgtcatcgagcttttgcaattagcagtgagagtcgtgcaagtgatacaatg
ttgagatttcacgattgttgtcagaactataagtctttcagaaaaagtagggaacctggt
gttgataagcttaagaggcctgtcttggatgaggttaccaattcgttagtgctgcggtac
gggctaaattttacaaggcatgatacttcttctctctggtttctttgcaagcaggaggca
tctcttcttagcaaacctgatcaagcttgtgccatgtttagtccttccgaggttgcttta
ttggagtggacagacgatctggagtcgttcatattgaaaggttatggtaatgcactgaat
tacagaatgggagtgcctttacttgaagacgtcgttcaatccatggagcaggccattaaa
tctaaagaagaaaaacaagctccggggagctatgaaaaagctaggcttcggtttgctcat
gcagagacattgctgcctttctcatgtttaataggcctttttctggaaggatctgaattt
gaacaaattcgtcaagaacaagccttgcaactccctctaaaacctcctcactcgagaaag
tggagaggcagcatagttgcaccctttggtggaaataatatgctagttttgtatagttgt
ccagctaacaactcgagcaaatacttggtgcaagtactgcacaacgaacatcctgttcct
ctgcctggctgtgataattctaatatttgtccatttgaagttttcaaggaaagaatagtt
gctccccatctgaagcatgattacaatcaagtctgcaatgcactatctgaagaagcttca
gagcaaaattttctgttctttaagctgaaacagatgttcagttggctattctctccgaag
aatagtggtaaacagaaccacaatgttgagctatag

DBGET integrated database retrieval system