KEGG   Daucus carota (carrot): 108213777Help
Entry
108213777         CDS       T05350                                 

Definition
(RefSeq) tyrosine/DOPA decarboxylase 1-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
dcr  Daucus carota (carrot)
Pathway
dcr00350  Tyrosine metabolism
dcr00360  Phenylalanine metabolism
dcr00380  Tryptophan metabolism
dcr00950  Isoquinoline alkaloid biosynthesis
dcr00965  Betalain biosynthesis
dcr01100  Metabolic pathways
dcr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    108213777
   00360 Phenylalanine metabolism
    108213777
   00380 Tryptophan metabolism
    108213777
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    108213777
   00950 Isoquinoline alkaloid biosynthesis
    108213777
   00965 Betalain biosynthesis
    108213777
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dcr04147]
    108213777
Enzymes [BR:dcr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     108213777
    4.1.1.105  L-tryptophan decarboxylase
     108213777
Exosome [BR:dcr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108213777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 108213777
NCBI-ProteinID: XP_017241057
UniProt: A0A166C0J6
Position
3
AA seq 493 aa AA seqDB search
MGSLSTQKFNPLNLDFFSSESNKVIEFITAYYKNVEKYPVRSQVEPGFLLNMYPKKAPSQ
PVSLDTILQELEADIIPGMTHWQSPNFYAYFRTTTSNAAFQGEMLCNALNVAGFNWICSP
AATELEMIVMDWLGKMLSLPQSFLFAGNGGGVLQGSTSEALICVLSAARDRALKQYGEDS
ITKLVVYASDQTHFVVKKAAKLVGIPTKNFRVIPTSIATCFALKPNDIKMAIERDLESGL
VPLFVCATVGATPSGSVDPVEGLGLLAKNYGLWLHIEAAYAGSAFICPELTHYLRGIEHA
HSISINLHKWLLTNMDCSCLWVKSPDVLLESLSMTDEILRNEASESKKVVDFMDWQIATS
KLFRALKLWFVLRRYGVDNLMAHIRSDIELAKHFEALVNSDKRFEVVVPVNFSLVCFRLK
PNEEGEESLKVLMNWNLMEAVNSSGRAYMTHAVLGDIFVIRCAIGTSLTEERHVNELWKL
ILEKTEVILKRDQ
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcctctcgacccaaaaatttaaccccttgaacctagactttttttccagtgaa
tcaaacaaagtgatcgagttcatcacagcttactacaagaatgtcgagaaatacccggtt
cgaagccaagttgaacctggttttcttctcaatatgtatccgaaaaaagctccctctcag
ccagtttcacttgatactattctccaggagcttgaagctgacattattccaggcatgacc
cattggcaaagccccaacttttacgcgtatttccgcacaactacaagtaatgctgctttt
cagggagagatgctctgcaatgctctcaacgtcgccggattcaactggatatgttctccg
gcagccactgagcttgaaatgattgtcatggattggctaggcaaaatgcttagcctccct
cagtcatttcttttcgcggggaatggtggtggagttttacaaggaagtacttctgaagca
ctaatatgtgtactttctgctgcaagagacagagctttgaaacaatatggtgaagatagt
atcacaaagctagttgtttatgcctctgatcaaacacattttgttgtcaagaaggcagct
aaattagtagggattcctactaagaattttcgtgtcataccaacatctatagctacttgc
tttgcactaaaaccaaatgatattaagatggctattgaacgtgacttggagtccggttta
gttccattgtttgtttgtgcaacggttggagccacgccttccggctccgtagaccctgtg
gagggacttggattattggccaaaaattatggcttgtggcttcatattgaagctgcatat
gctggaagtgctttcatttgtcctgagcttacgcattatcttagaggcatagagcatgct
cattctataagcataaatctccacaaatggttattaacaaacatggactgtagttgcctc
tgggtgaaaagtccagatgttctgttggagtctttgtccatgactgacgagattctgaga
aatgaggctagtgaatccaagaaggttgtggacttcatggactggcagatcgccacaagc
aagctattcagggctctgaagctgtggtttgtgctgcgtcgatatggtgtggataatctg
atggcacatatcagaagtgacattgaattggccaagcattttgaggcattggttaattct
gacaagaggtttgaggtggtggtgcctgtcaatttttcgcttgtttgctttcgactaaaa
ccgaatgaggaaggagaggagagcttgaaggtcttgatgaactggaatctgatggaggca
gtgaattcaagtggaagagcttacatgactcatgccgtgttgggtgatatatttgttata
cgctgtgctattgggacttcattaactgaggaaaggcatgttaatgaattgtggaaattg
attctcgaaaaaactgaggtcatcttgaagcgagaccagtga

DBGET integrated database retrieval system