KEGG   Daucus carota (carrot): 108215406Help
Entry
108215406         CDS       T05350                                 

Definition
(RefSeq) short-chain dehydrogenase TIC 32, chloroplastic isoform X1
  KO
K11153  retinol dehydrogenase 12 [EC:1.1.1.300]
Organism
dcr  Daucus carota (carrot)
Pathway
dcr01100  Metabolic pathways
Brite
Enzymes [BR:dcr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.300  NADP-retinol dehydrogenase
     108215406
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase CheD
Motif
Other DBs
NCBI-GeneID: 108215406
NCBI-ProteinID: XP_017243396
Position
3
AA seq 319 aa AA seqDB search
MGIFSLMTGMAGASGFGSASTAEQVTDGIDASNLTAIITGGASGIGFETARVLALRRAHV
VIATRNVEAANEAKQLILKEQENARVDVLKLDLCSIKSVRAFADSFKALNLPLNILINNA
GIMFCPYKLSEDGIEIQFATNHLGHFLLTNLLLDKMKETAKSTGVEGRIVNLSSIAHQHT
YSEGILFEKLNDEKSYSDKKAYGQSKLANVLHANELSRRLQAEGANITVNSVHPGLIMTN
LFKYSTVLFKILKMVTPLIWKNVPQGASTTCYVALHPNLKGVSGKYYQDCNEWQPSKFAT
DEKLAKKLWDFSNKLVNSV
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgggtatattttcattgatgacaggaatggcaggagcaagcggcttcggatctgcttca
actgctgaacaagtcactgacggaatcgatgcttccaatctcactgccatcataaccgga
ggggcaagtggaattgggtttgagacagcaagagtattggcactgaggagagctcatgtg
gtaatagcaacgaggaatgtagaggctgcaaatgaagcaaaacagcttattcttaaagaa
caagaaaatgctcgcgtcgatgttcttaaacttgacctatgctccatcaaatccgtcagg
gcatttgctgatagcttcaaggctcttaaccttccgctcaacattctcataaacaatgct
ggcattatgttttgcccttacaaactttcagaagatgggattgagatacaatttgcaaca
aaccatctggggcatttcttgttgacaaacctactactggacaagatgaaggagacagca
aaatctacaggtgtcgaaggaaggattgtgaatctatcttcgatagctcaccagcatact
tattctgaaggaatactattcgaaaagctcaatgacgaaaagagttattcggacaaaaag
gcatatggacaatcgaaattagctaatgtattgcatgctaatgagctgtctcgacgtcta
caggcggagggagcaaatattactgtgaactcggtgcatccaggattgatcatgacaaac
ctctttaagtactcaaccgttctgttcaaaattcttaagatggtaactcctctcatctgg
aagaatgtcccacagggggcatccacgacttgttacgtagctctgcaccctaatttaaaa
ggtgtgagtgggaagtattatcaggactgtaacgagtggcagccaagcaaatttgcaacg
gatgagaagttggccaaaaaactctgggacttcagcaacaagctggttaactctgtttga

DBGET integrated database retrieval system