KEGG   Daucus carota (carrot): 108218804
Entry
108218804         CDS       T05350                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
dcr  Daucus carota (carrot)
Pathway
dcr00100  Steroid biosynthesis
dcr01100  Metabolic pathways
dcr01110  Biosynthesis of secondary metabolites
Module
dcr_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    108218804
Enzymes [BR:dcr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     108218804
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 108218804
NCBI-ProteinID: XP_017247412
Position
4
AA seq 371 aa
MRMDLNHLLNSLIPSWNSAGLLLVYFTYLRLAGSVLPGKLVPGVTLSDGSRLYYRCNGLA
SLVLLVALLGLGAWADFVSPAVIADRGLELLSTTFIFSVIVTSLLCAVGSKSSSQSSSLK
PYVTRNKLNDWWLGIQLNPHFMGIDLKFFFVRAGMMGWLLINLSVLGKCFENSSLSQSMI
LYQLFCLLYILDYFIHEEYMTSTWDIIAERLGFMLVFGDLVWIPYTFSIQGWWLLYNKVE
LTTAAVIANCFVFLIGYMVFRGANKQKHVFKKNPKALIWGRPPKVIGGKLLVSGYWGIAR
HCNYLGDLLLALSFSLPCGISSPVPYFYPIYLLILLIWRERRDEARCAQKYKDVWAEYCN
VVPWRILPYVY
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgcgaatggatctgaatcatcttctcaattcattaatcccttcctggaactctgctggt
ttgctactagtgtatttcacttacttgagattagctggatctgttttacctggaaagctt
gttcctggagtcaccttatccgacggctctcgtctctactaccgttgcaatggattggca
tctcttgtgctgctagtagctctacttggacttggagcctgggcggatttcgtatcgcct
gctgtgatagcagatagaggactcgaacttctgtcaacaacttttatattcagtgttatt
gtaacatcattactttgtgcagtcggtagcaaatcttctagtcagagttcatccctgaaa
ccttacgtcacaagaaacaaactcaatgactggtggctggggatacaattgaatcctcat
ttcatgggcattgacctcaaattcttctttgttagagctgggatgatgggatggctactt
atcaatctctcagttcttggaaaatgttttgaaaacagcagtttgagccagtcaatgatt
ctctatcaattattctgtctgttatacatccttgattatttcattcatgaagaatacatg
acatctacgtgggatataattgcagagagattgggcttcatgctagtgtttggagatcta
gtttggattccctacacctttagtatacagggttggtggctgttgtataataaagtggag
ctaacaacagcggctgttattgcaaattgttttgtctttcttatcgggtatatggtgttt
cgaggagcaaacaagcagaagcacgtctttaaaaagaatccaaaagcactaatatggggt
agacctccaaaggttattggagggaagctgcttgtatctggttattggggaattgcaagg
cactgtaattaccttggtgatttgttattggcattgtcctttagtttgccttgtgggata
agttccccagttccatatttctacccaatatatctccttattttgttaatatggagagaa
agaagagacgaagcaaggtgtgcacaaaagtataaagatgtatgggcagaatattgtaat
gtggttccctggagaatactcccttatgtttattag

DBGET integrated database retrieval system