KEGG   Daucus carota (carrot): 108219611Help
Entry
108219611         CDS       T05350                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
dcr  Daucus carota (carrot)
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dcr04131]
    108219611
Membrane trafficking [BR:dcr04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    108219611
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin ANAPC4_WD40 WD40 zf-RING_2 zf-RING_11 zf-C3HC4 zf-RING_UBOX
Motif
Other DBs
NCBI-GeneID: 108219611
NCBI-ProteinID: XP_017248622
Position
4
AA seq 954 aa AA seqDB search
MSNNQSENRTDGDNERDEEKEEDVSGEDEEEEAEDEPRLKYQRMGGSVPALLSGKSASCI
EVAERMIALGTRAGSVHILDFLGNQVKEFLAHGATVNDLCFDIEGEYIASCSDDGSVAIN
SLYTDAKLKFDYHRPMKAIALDPYYARNSSKRFVVGGLAGHMYYNIKKWIGYRDQVLQSG
EGPIHAVKWRTSLVAWANDGGVNVYDTSNDQRITYIERPRGSLRPTLLFPHLVWQDDSLL
VIGWGTSVKIALIKSNQNSSTNKTYKHIQMSHMDQVDIVASFQTSYYISGIAPFGENLVV
LAYIPEEDGEKEIASSISSHQGNARRPEVHVVTWSNDELSTDALPVHGFEHYKAKDYLLA
HAAFTGNSYTGGQWAAGDEPFYYIVSPKDVIIAKPRDAEDHISWLLQHGWHGKALEAVEA
GKGSIQLLDKVGSKYLDHLIGRRNYAKAASLCPKLLQGSASAWERWVFHFAHLQQLSLLV
PYMPTENPRLRNTAYEVALVALVTNPSFHKELLSTVKAWPPLIYSAVPVISAIEPHLNTS
YMTDALKEALAEIYVINAQYEEAFSLYADLLKPDLFEFIEKHNLHDSIREKVVQLMKIDS
KRAVTLLIQHMEMISPNEVVSQLLATEDDSRYFLYQYLHSLFEDDPHAGRDFHDMQVELY
ADHDPKVLLRFLRNCQHYKLMKAYEICVSRGLLREQVYILKRMGNSKQALVVIINELGDI
EQAIEFVSMQHDDELWVELIRQCIQNPEMVGVLLEHTDGNLDPLYIVNIIPNGLEIPRLR
DRLIKIIKDYRTETSLRRGCNNILKGDIINLLIKYYEDARRAIYMSNEEDEVRSTRDDDT
ASNLMERSRNMKTMDIKSKTRAGGRCCVCFDPFSIQNVSIIAFYCCHAYHRTCLLDSANT
VDEKKTPAPTSHEDAWYYEYEKSDPDNVDDNNINTLGSPQMRCILCTTATSTSH
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgtctaataatcagtcggaaaatagaaccgacggcgacaacgagagagacgaagaaaaa
gaagaagacgtgtccggtgaagatgaagaagaagaagccgaagacgagccgagactaaag
taccagagaatgggaggcagcgtgccggcgcttttatccggcaagtcggcgtcatgtatt
gaggttgctgagcgtatgatcgctctcgggactcgcgctggttctgtacacattctcgat
tttcttggaaaccaggtaaaggagtttttagctcatggtgctactgtcaatgatttatgc
tttgacatagagggtgaatacattgctagctgttcggatgatggatcggtggcaataaac
agtctgtatactgacgcgaaactgaaattcgattatcatcgtccaatgaaggctattgct
ctggacccatattacgcacgaaattcctccaaaagatttgttgttggcggtttagctggc
catatgtactataatataaaaaagtggattggttatcgtgaccaggttcttcaatcaggt
gaaggtccaattcatgcagtgaagtggagaacaagtctcgttgcttgggctaatgatgga
ggagtgaatgtttatgatacttcaaatgatcaacgtataacgtatattgagagaccacgt
ggaagcctacgtcctacacttctgtttcctcacttagtttggcaggatgatagtttattg
gtcattggttggggaacatctgtgaaaattgctttgataaagagtaatcagaacagtagc
accaacaagacttataaacatatacaaatgtcccacatggaccaggtggacatagtggca
tcatttcaaactagctattacatctcaggaatcgctccttttggagaaaatttggttgtt
ctagcttatattcctgaagaggatggtgagaaggaaattgcaagcagcatttcatcgcac
cagggaaatgctcggagaccagaagtgcatgtagtcacatggagcaatgacgagctttca
acagatgcactgcctgtacatggctttgagcattacaaggcaaaagattatctccttgct
catgctgcgttcacaggaaacagctacacaggtggtcagtgggcagctggtgatgagcca
ttttattatatcgtatctcctaaagatgtaattattgcgaagcctagggatgcagaagat
cacatatcttggcttcttcaacatggatggcatggaaaagctttagaagcagttgaagca
ggaaaaggaagcatacagcttcttgacaaagtgggttcaaaatatcttgatcatttaatt
gggagaagaaattatgctaaagctgcatctttatgcccaaaattgttacaaggctcagcc
tctgcatgggagagatgggttttccactttgctcatctacagcagctttctcttttggtt
ccttatatgccaacagaaaatccaaggttgcgcaatactgcatacgaggttgctcttgtg
gctctggtgacgaatccatccttccataaggaacttctgtcaaccgttaaagcctggcct
cctctaatttactctgcagtgcctgtcatttcagctatagaacctcatcttaatacttcg
tacatgactgatgctctcaaagaggcactggcggagatatatgttattaatgcacaatac
gaggaagccttttcactttatgctgatcttttgaagccagatttgttcgagttcatcgaa
aaacataacttgcatgattccatccgtgagaaggttgtacaattgatgaaaatagatagt
aaacgggcagttacattattaatccagcacatggaaatgattagtccaaatgaagttgtt
tcacaactattggctacagaggacgactccagatactttttatatcaatatctgcactct
ctctttgaagatgacccccatgcaggaagggatttccacgatatgcaggttgagctttat
gcggaccatgatccaaaggtgctgcttcgttttctccgcaactgtcagcattataagctt
atgaaggcatatgaaatatgtgttagcagaggtctgctgagggagcaagtttacattctt
aaaagaatgggaaattccaaacaggcccttgtagttattattaatgaactaggggatata
gaacaggccatagagtttgttagtatgcaacatgacgatgaactgtgggtagaattgatc
agacaatgtattcagaatcctgaaatggttggggtgttgctggagcataccgatggcaat
cttgatcccctctatattgtaaatatcattcccaatggcctggagattcctcggctaagg
gatcgtttaattaaaatcataaaggactacaggaccgaaacttctctaaggcgtggttgt
aataatatacttaagggtgatattattaacctgttaattaaatactatgaggatgcaaga
cgtgccatctacatgagcaatgaagaagatgaagtgcgttccacaagggatgacgataca
gcgtctaatttgatggagagatcaaggaacatgaaaaccatggatatcaagtcaaaaact
agagcaggcgggaggtgctgtgtgtgttttgatcccttttccattcagaatgtatccatc
attgcattctactgttgtcacgcatatcataggacttgcctcttggattctgctaataca
gttgatgagaagaaaacgccagcccctacttcccacgaggatgcatggtattatgagtac
gagaagagtgaccctgataatgttgatgacaataatattaatactttaggttccccgcag
atgcgatgtatattgtgcaccaccgccacaagtacatcacattga

DBGET integrated database retrieval system