KEGG   Daucus carota (carrot): 108219887Help
Entry
108219887         CDS       T05350                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK11
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
dcr  Daucus carota (carrot)
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dcr01001]
    108219887
   01009 Protein phosphatases and associated proteins [BR:dcr01009]
    108219887
Enzymes [BR:dcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108219887
Protein kinases [BR:dcr01001]
 Serine/threonine kinases: Other
  Wnk family
   108219887
Protein phosphatases and associated proteins [BR:dcr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108219887
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo APH
Motif
Other DBs
NCBI-GeneID: 108219887
NCBI-ProteinID: XP_017248937
Position
5
AA seq 301 aa AA seqDB search
MTLTMPSVSPDSSDQDREPFVEVDPSGRFGRYSDLLGAGAVKKVYRGFDQEEGRDVAWNQ
VRLRKFCDDPSIISRLFSEIELLQTLKNENIIVLYSFWKDVEHNTLNFITEACASGNLRD
YRKKHRHVSVKALKKWSRQILAGLDYLHNHDPCIIHRDLNCSNIFINGNIGKVKIGDLGL
ATVVGRSHVAHSLLGTPEYMAPELYEEDYTELVDIYSFGMCLLEMATMEIPYSECDSIAK
IYKKVTSGVKPKAIDKVSDPDLKAFIERCIGQPRARPSASELLKDPFLAETENTETDSTI
I
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgacgatgccatccgttagtcctgactcatctgatcaggatagagaaccattt
gttgaggttgatccatctggacgttttggtcgatacagtgatctactaggtgctggtgct
gttaaaaaggtatatagggggtttgatcaagaggaaggtcgagatgttgcatggaatcag
gtacgtctgaggaagttttgcgacgatccgtccatcatcagtaggcttttctcggaaatt
gagttgctgcaaacactgaagaacgagaacatcattgttctatacagtttctggaaagac
gttgaacataatactttgaacttcattactgaggcatgtgcatccggaaatcttagggat
tacaggaagaagcatcgccatgtgtcagtgaaggctttaaagaagtggtcgagacagata
ctggctggtttggactatttgcataaccatgacccatgtataattcatagggacctgaat
tgcagcaacatattcattaatggaaatattggaaaggtcaagattggtgatcttggatta
gctacagtggtagggaggagccatgttgctcattcactgctagggacacccgagtatatg
gcgccagagctgtatgaagaggactacacggagttggtagacatatattcatttggtatg
tgcttgcttgaaatggctacgatggaaataccatacagtgagtgtgatagcatcgccaaa
atatacaagaaggttacaagtggagtgaaacctaaggccattgacaaagtaagtgatcca
gacttgaaggcatttattgaaagatgcattggtcagccccgagcaagaccgtctgcctcc
gaacttctgaaggatcctttcctcgcagaaacagagaatactgaaaccgacagtactatt
atttga

DBGET integrated database retrieval system