KEGG   Daucus carota (carrot): 108220005Help
Entry
108220005         CDS       T05350                                 

Definition
(RefSeq) L-type lectin-domain containing receptor kinase IX.1-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
dcr  Daucus carota (carrot)
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dcr01001]
    108220005
Enzymes [BR:dcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108220005
Protein kinases [BR:dcr01001]
 Serine/threonine kinases: TKL group
  IRAK family
   108220005
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_legB Pkinase Pkinase_Tyr Bact_lectin Lectin_leg-like Beta-APP
Motif
Other DBs
NCBI-GeneID: 108220005
NCBI-ProteinID: XP_017249127
Position
1
AA seq 688 aa AA seqDB search
MAAHSFSLSALCIMIITFLIFQSIPVAASLSFTFSNFSNTSELFFDRNATLSNNIIQLTA
ELASMGRATYYRPMSLWDEKSRNLTDFTTHFAFSIDSQNQRRYGDGITFFLAPVGSRIPR
NATKGGTLGLTTDEQQWNSTDNPFVAVEFDVYESNYDPVGDHVGIDLSSMISVANVSWLG
ANTSVMKGLRNDAWITYHSSSKNLSVIFTALSNNRTINQSLSYIVDLRDYLPPNVTFGFS
GSTGNRSAICSIYSWGFNTSLELHETLTDLINQAPSSSDNKGMLIGLLVGGALVVCVGIL
ALAYYRKRRNGEEDEDEITFDDTMDGEFERGTGPKKFSYHSLAKATKNFAEEQKLGEGGF
GVVYRGFLRTLNCDVAVKRISRTSKQGVKEYASEVKIITRLRHRNLVQLLGWCHEKNDLL
LVYEYMQNGSLDSHLFRGKSLLTWPIRYKIAQGLASSLVYLHEACEQCVVHRDIKSSNVT
LDSNFIAKLADFGLARLVDHEKGGQTTVFAGTLGYMAPECITTGQASKESDVYSFGIVSL
EIAGGRKVIDPNFDESRMRLLQWVWSLYGTGELLQAADPKLCGDYDEQELQRLMIVGLWC
AHPDKTFRPSIRQAIHVLTLEAPLPILPPTMPVATYYPPLNMSTAALAMAYGQTVWKHRP
GESSGNQNNESSSNASTDSTFQSVLYPR
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcatagttttagcttatcagcactttgcattatgatcattacattcttgatc
tttcaaagtatcccagttgcagcttctttgtccttcaccttcagcaatttcagtaacact
agtgaattgtttttcgaccgaaatgcaactttatcaaacaacataattcaactcactgca
gaactagcatccatgggtagagccacatattatagaccaatgagtctgtgggatgaaaaa
tcaagaaacctgacagacttcacaacgcattttgccttcagtatagattcgcaaaaccag
agaagatatggcgatgggatcacgttctttttggctccagttggttccaggattccaagg
aatgcaacaaaaggtggcacccttggcctcacaactgatgagcagcaatggaattcgaca
gacaatccgtttgttgcagttgagtttgatgtttacgagagtaattatgatcctgttggt
gatcatgtaggtattgatctcagctctatgatatctgttgctaatgtgagttggttaggt
gcaaatactagtgtcatgaaagggttgagaaatgatgcttggataacttatcattctagc
tcgaaaaatctcagtgttatctttactgctttgagtaataacaggactatcaatcagagt
ctttcgtatatagttgatttaagagactatttgccaccaaatgttactttcggcttctct
ggttcaactggaaaccgatcagctatatgtagtatttactcatggggtttcaatacaagt
ctagagctacatgagactttgacagatttgattaatcaagcaccaagctcctcggataac
aagggaatgctgattggattattagtggggggagctcttgtagtctgtgttggtattttg
gcattggcgtattatagaaagagaaggaatggagaggaggatgaagatgaaatcacgttt
gatgatacgatggatggggaatttgaaagaggtaccggacctaaaaagttttcatatcat
tcgctggctaaggcaacaaagaactttgcagaggagcagaagcttggagaaggaggcttt
ggtgtggtttatagaggtttcttgagaacactgaattgtgatgttgctgttaagaggata
tcaaggacttcgaagcagggagtgaaggagtatgcatcagaagtgaagatcattactcga
ttaagacataggaatctggtgcagctgctgggatggtgtcatgaaaagaatgatcttcta
cttgtttatgagtatatgcagaatggtagcttggattctcatctttttcgagggaaaagc
ttgttgacatggccaataagatacaaaattgcacaaggcttagcctcatcactggtttat
ctacatgaagcatgtgagcaatgtgtagtccatagggatattaaatcaagcaatgttaca
ttggattcaaatttcatagcaaaacttgctgattttggattagcaagattggttgatcat
gaaaaaggagggcaaacaactgtttttgctggaactctgggatacatggctcctgaatgt
ataactacaggccaagccagtaaagaatcagatgtttacagctttggcattgtttcacta
gaaatagcaggtggaagaaaagtaattgatccgaattttgatgaaagtcgaatgagactg
cttcaatgggtctggagcctatatggaacaggagaacttcttcaagctgctgatccaaaa
ctctgtggagattacgatgagcaagaactgcagcgattaatgattgttgggctttggtgt
gcacatccagataaaacttttcgaccttcaattagacaagccattcatgtccttactctt
gaggctccattgcctattcttccaccaactatgcctgtcgcaacatattatcctccattg
aacatgtcaacagctgctctagctatggcatatggtcagactgtctggaaacatagacca
ggtgaatcttctggtaatcaaaataatgaatcctcaagtaatgcttccaccgattctaca
tttcaatcagttctgtatcctagatga

DBGET integrated database retrieval system