KEGG   Daucus carota (carrot): 108223764Help
Entry
108223764         CDS       T05350                                 

Definition
(RefSeq) rust resistance kinase Lr10-like isoform X1
Organism
dcr  Daucus carota (carrot)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr GUB_WAK_bind Pkinase_fungal Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 108223764
NCBI-ProteinID: XP_017253661
Position
5
AA seq 650 aa AA seqDB search
MMSSSLLLVITVVLASITSSCCKADSPTFSSCGNIDNISCPFYLKDQPFKCPDFSYELSC
RQNLTIIKLFSDDFYVEAINYVNSTIRIIDAGLARNNYSCSSTPLHRFYSFDGFFTPIME
LNRPITYIDCPAPVTNPYSTRYFLTPPCSLSIYSYIVIGYMNISEMENNCTIRKAAWVSS
GWPNINKTSFLGPRDMVYGMEFRFQYFSCLKCLGTQSQYCRSVVTENQINKCQSDTFSIW
SYVRYALDLILVYADYIAGNLGMRIYKGDYNDVSVQKYLAMSVELLILVVAARFLCGLPF
VSAFFVYKSRRRHLSVYGTIEDFLQGQNNLRPIRYNYSQIKKLTKGFNEKLGEGGFGTVY
KGKLRSGLVVAVKILNSSRTSDEDFINEVGTIGMIHHVNIVRLVGFCVEGPKRALIYEFM
PNGSLDKYIFTEGRGTSTLSCEKIYEISCKVACGIEYLHRGCDMQILHFDIKPHNILLDE
NFNPKISDFGLAKLRATDQSIVTMTAARGTMGYMAPELFYKNIGRVSYKADIYSFGMLLL
EMAGQRKNLNPFENQISQIYFPSWIYDQISQGKEIEMREVTENEKELVKKMIIVAMWCIQ
MNPSERPSMNRVIEMLEGDVELLVIPPKPLICPQRETLNDDEELMQTSLY
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcttcgtcgttgttgttagttatcactgtagttttggcatctataaccagcagc
tgctgcaaagcggattctccaacattttcttcttgcggtaatattgataacataagctgc
cccttttatctaaaagatcaaccattcaaatgtcctgatttcagctatgagctttcctgc
agacaaaatcttactattatcaaacttttctcagatgacttctatgtggaggctataaat
tacgtgaattccactatccgtatcatcgatgcagggctagctagaaataattattcatgt
tcgtccactcctctccatagattctacagttttgatggtttttttaccccgattatggag
ttgaataggccaataacttatatagattgtccggctcccgtgacgaatccctactcaact
cgatattttcttacacctccctgctcattatcaatctattcatacatcgtcattgggtat
atgaatatctcagaaatggagaataattgcacaattcgtaaggcagcttgggtgtcatca
gggtggcctaatattaataaaacatctttcttgggtcctcgtgatatggtttatgggatg
gagtttcgtttccagtacttctcttgcctaaagtgtcttggtactcaatcacagtattgt
cggagtgtggtgaccgaaaatcaaatcaacaaatgccaatctgatacttttagtatatgg
tcgtacgtgcgatatgctttggatttgattcttgtttatgcagactatattgcaggaaac
ctaggcatgcggatctacaagggcgactataacgatgtctcagtgcaaaagtatctagca
atgtcagtagagctcctcattctggttgttgctgcaagatttttgtgcggactaccattt
gtatccgcgttcttcgtatataaatcgaggagaagacatctatcagtgtacggcaccatt
gaagatttcctacaaggacaaaataatctgagacctattaggtacaattattctcagatt
aagaagctcactaaaggatttaatgagaaacttggtgaaggaggttttggtactgtatat
aaaggaaaacttcgaagtggccttgttgtagctgttaaaatacttaacagctccaggact
agcgacgaagatttcatcaatgaagttggtacaatcggtatgatccatcatgttaacatt
gtgcgacttgttggcttctgtgtcgagggtccaaaacgtgctctcatatatgagttcatg
cctaacggatctcttgataagtacattttcaccgaagggagaggaacatccactttgagc
tgtgaaaagatttatgagatttcctgcaaggtggcctgtggcattgagtatctacatcga
ggctgtgatatgcaaatcttgcattttgatattaaacctcacaacattcttctagatgaa
aatttcaatcccaaaatttctgattttggtcttgcaaaattacgcgctactgatcaaagt
atagtgacaatgactgcggcaaggggaacaatggggtacatggctccagaattgttttac
aaaaatattggacgggtttcttataaggcagatatttatagtttcggaatgttgttactg
gaaatggcgggacaaagaaaaaacctaaatccattcgagaatcagattagccaaatttac
ttcccttcgtggatatatgaccaaattagccaagggaaggagattgaaatgcgagaggtc
accgaaaatgaaaaggagttggttaagaagatgattattgtggcgatgtggtgcatacaa
atgaatccaagcgagcggccttcaatgaacagagtgattgaaatgcttgaaggtgatgtt
gaacttttggtgatccctcctaaaccattgatttgtccacaacgggaaacgttgaatgat
gatgaagaacttatgcagacctctctgtactga

DBGET integrated database retrieval system