KEGG   Daucus carota (carrot): 108225074Help
Entry
108225074         CDS       T05350                                 

Definition
(RefSeq) probable phospholipid hydroperoxide glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
dcr  Daucus carota (carrot)
Pathway
dcr00480  Glutathione metabolism
dcr00590  Arachidonic acid metabolism
dcr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    108225074
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108225074
Enzymes [BR:dcr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     108225074
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF1548
Motif
Other DBs
NCBI-GeneID: 108225074
NCBI-ProteinID: XP_017255378
Position
1
AA seq 167 aa AA seqDB search
MASAQCYSVHDFVVKDAKGNDVDLSQYKGKVLLIVNVASQCGLTNKNYTELSELYEQYRG
SGFEILAFPCNQFAGQEPGTTEQIANFVCTKFKAEYPVFDKIHVNGSSASPLYKFLKSSK
HGTFGDNIKWNFTKFLVDREGNVVNRFSPTTAPHKLEKDIKKLLDEA
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgcccagtgctattcggttcatgatttcgttgtcaaggatgctaaaggcaat
gatgtcgaccttagccagtacaagggaaaggttctgctgatcgtcaatgttgcatctcaa
tgtggcctgacgaataaaaattacacagagttgtcagagctgtacgagcagtacagggga
tcaggtttcgagattctggcttttccctgtaatcaatttgcagggcaggagcccgggact
actgaacaaattgcaaattttgtttgcaccaaattcaaagctgaatatccagtattcgac
aagattcatgttaatggttcaagtgcatctccactgtacaagttcctgaagtctagcaaa
catggaactttcggggacaatatcaagtggaatttcaccaagttcttggtggatagagag
ggaaatgtagtcaatcgcttttctccaacaactgctcctcataaacttgagaaggacata
aagaaactgttggatgaagcttaa

DBGET integrated database retrieval system