KEGG   Daucus carota (carrot): 108226099Help
Entry
108226099         CDS       T05350                                 

Definition
(RefSeq) probable inactive receptor kinase At2g26730
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
dcr  Daucus carota (carrot)
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dcr01001]
    108226099
Enzymes [BR:dcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108226099
Protein kinases [BR:dcr01001]
 Serine/threonine kinases: TKL group
  IRAK family
   108226099
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase DUF4719 UL42 Vpu
Motif
Other DBs
NCBI-GeneID: 108226099
NCBI-ProteinID: XP_017256538
UniProt: A0A161XDK1
Position
6
AA seq 467 aa AA seqDB search
MSNSQIFIHVLAITTLLYVNIIHAAVAYDETKAPLPRKTRFSKRVESTVVHITTNNDSAA
DKRKLKYAFALAVVDVIGLIVIAVLFYVYYKKNRRLKEDMRRLNLNQKIEDQKDEQMVDK
GKRVADSEEHQDKDKVQLTFMEGVASFELNDLLKASAEGLGKGNFGNSYRATFDDGRAVV
VKRLRDLKPLSGDEFVKQVRGIAELDHPNLLPLLAYYYSKNEKFLVFKFAVNGNLYNRLH
GGKGTRNRIPFPWSSRLAVARAVAKSLEYLHLNYHIPVPHANLKSTNILLDENDTVLLSD
YGLTSIVAPPIAVQRMVSFKSPEFQMSKRVSKKSDIWCFGALLLELLTGKVCVHSAPPEA
NGIDLCSWVHRAVREEWTAEIFDPEVSSRTGAYNAMVGVLQMAMRCCDKLPEKRPNISEL
VRELENVKSVIIDSEDDEDLSMDRSSYTDESLSEKSIIIGDARKFAN
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtctaactcgcaaatttttatacatgttcttgctattaccactcttctttatgtaaac
attattcatgctgcagttgcttatgatgaaacgaaagctcctttgcctcgcaagacaaga
tttagtaaaagagttgagagtactgttgttcatataaccacgaataatgactctgctgca
gataaaaggaaattgaagtacgcgtttgctttggcagttgttgatgtgataggcctaatt
gtgattgcggttttgttctatgtatactacaaaaagaacaggaggcttaaggaagacatg
aggagattgaatttgaatcaaaaaattgaagatcagaaggatgagcagatggtagacaaa
ggaaagagagtggctgatagtgaggaacatcaagataaagataaagtgcagcttactttt
atggaaggcgttgcgagttttgaacttaatgatcttttgaaagcttctgctgaggggttg
gggaaagggaatttcgggaactcctatagagctacatttgatgatggtagagctgttgtc
gtaaagcgactaagggatctgaagcctttgagtggtgatgagtttgtgaagcaagtcagg
ggaattgcagagcttgatcaccctaacttgttgccacttcttgcttactactattctaaa
aatgagaagtttttggtcttcaagtttgcagtcaatgggaatttgtacaatcgccttcac
ggaggtaaagggacgaggaatcggatcccatttccatggagctctaggctagcagtggct
cgtgctgtagctaaaagtttggagtatttgcacctcaattatcacatccctgtgccccat
gcaaacttaaaatcaaccaacattctgctagatgaaaatgatacggtactcttatcagac
tacggcttaacctcaattgtagcgcctccaatagctgttcaacgcatggtctcattcaag
tcacccgaattccaaatgtccaaaagggtgtccaagaaatccgacatctggtgcttcggt
gccctgcttctggagctcctgacaggtaaagtttgcgtacattctgctccaccagaagcc
aatggcattgatctctgcagctgggttcaccgcgctgtcagagaagaatggacagctgaa
atctttgaccctgaagtatcttcaagaacaggagcctacaatgcaatggtgggagtgctg
cagatggccatgagatgctgtgacaagttgccagaaaaaaggcctaacataagtgagctg
gtgagggagcttgagaatgtcaagtctgtgatcattgattcagaagatgatgaggactta
tcgatggatcgatcatcgtacaccgatgaatcattgtccgaaaaatcgatcataattgga
gatgccagaaaatttgctaactga

DBGET integrated database retrieval system