KEGG   Dendrobium catenatum: 110092102Help
Entry
110092102         CDS       T05027                                 

Definition
(RefSeq) photosynthetic NDH subunit of lumenal location 5, chloroplastic
  KO
K03768  peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC:5.2.1.8]
Organism
dct  Dendrobium catenatum
Brite
KEGG Orthology (KO) [BR:dct00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dct03110]
    110092102
Enzymes [BR:dct01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     110092102
Chaperones and folding catalysts [BR:dct03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    110092102
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase FAD-SLDH
Motif
Other DBs
NCBI-GeneID: 110092102
NCBI-ProteinID: XP_020672144
Position
Unknown
AA seq 256 aa AA seqDB search
MAATFSTIHSSVRPATVGSVAIHRCYTGSVFSIPKLRRRTLTSKELSSAAAFSPSILSLT
ASYSRRISHFTTLTKAVLQETPLQAKVTQKVYFDINIGNPQGNPDGRVVIGLFGDDVPQT
AENFRSLCTGEKGFGYKGCIFHRVIKDFMIQGGDFENGNGTGGKSIYGRTFKDENFKLSH
VGPGVVSMANAGPNTNGSQFFICTAKTGWLDGRHVVFGQVLEGMDFVRLIESQETDRGDR
PKKKVTIVDSGELPVA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggccgctaccttctccaccattcattcaagcgttcgtccagcaactgttgggtcggta
gccatccatcgatgctacaccgggagcgttttctccatcccaaagttacggaggcgtact
cttacttctaaggaattatcatcggctgctgctttctcgccgtctatcttgtcgctcacc
gcttcctattctcgccgcataagccacttcactaccttgactaaagcagtattacaggaa
acaccattgcaggcaaaggtcacccaaaaggtatattttgacattaacattggcaaccct
caggggaatcctgatgggagagttgtgatagggctctttggtgatgatgtaccccaaaca
gcggagaacttccgttctctgtgcacaggggaaaaaggctttggttataagggatgcata
ttccatcgtgtcataaaggatttcatgatacaagggggtgattttgagaacggaaatggc
actggaggtaagagcatatatggtcgtacattcaaagatgagaatttcaagttgtctcat
gtgggacctggagttgtaagcatggcaaatgcaggacctaatacaaatgggagccagttc
ttcatatgcactgctaagactggatggctggatggaaggcatgttgtgtttgggcaagta
ctggagggcatggattttgttaggcttattgagtcacaggaaactgaccgtggagatcgg
cccaagaagaaggtgactatcgtagattctggagagctgccagtggcttga

DBGET integrated database retrieval system