KEGG   Dendrobium catenatum: 110094386Help
Entry
110094386         CDS       T05027                                 

Definition
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
dct  Dendrobium catenatum
Pathway
dct00510  N-Glycan biosynthesis
dct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dct00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    110094386
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dct01003]
    110094386
Enzymes [BR:dct01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     110094386
Glycosyltransferases [BR:dct01003]
 Glycan extension
  N-Glycan
   110094386
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2
Motif
Other DBs
NCBI-GeneID: 110094386
NCBI-ProteinID: XP_028550403
Position
Unknown
AA seq 444 aa AA seqDB search
MAFYKRSHAGYRRLLPLFLVIFSVALVLMLLIRKWAISDFSYIAVEEESYSFPSSSMETD
NRILLNFGDFKPKLPKMNDFAISLDRRNFLPPRNIDLFPNLAENHINIVLYVHNRPQYLQ
VVLKSLANVKGIGETMLIVSHDGYFNEMDSIVQAVRFCQVKQIFSPYSPHLYSDSFPGVS
KGDCQHKDDPSKKNCSGDADQYGNHRSPRIVSLKHHWWWMMNTVWDGLPETRMHSGHILF
IEEDHFIYPNAYRNIQLLVKLKPAKCPDCFAVNLAPSDVKSKGEGWESLIAEKMGNIGYT
FNRTVWRKIHAKAREFCWFDDYNWDITMWSTVYPSFGTPVYTLRGPRASAVHFGKCGLHQ
GQDKISACIDNGEAKFELENVDKVPNINIDWPVYVFKNQEGYRAGFKGWGGWGDHRDQEL
CLSFAYMYHSSDALTNGRDASKHS
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggctttttacaagagatctcatgctggatatcggaggttgcttccgctgtttctggta
atattctcggtggctctggttttaatgttgctgattcgaaaatgggcaatttctgatttt
tcctacatagctgtagaagaagaaagttattcttttccttcgtcttctatggagactgat
aatcgtatactcttgaactttggagactttaaaccaaaacttcctaaaatgaacgacttt
gccatctctctggatcggagaaactttttaccaccgaggaatattgatctctttccaaat
ttagcggagaaccatataaatattgttctgtatgttcacaaccggccgcagtatcttcag
gttgtgcttaagagtttggctaatgtgaaggggataggagaaaccatgctgatagttagc
catgatggatacttcaatgagatggatagtattgttcaggcagtccggttctgccaggtg
aagcagatcttttctccatattcaccgcatctctattctgatagcttcccaggtgtttcg
aagggagattgccaacacaaggatgatccttctaagaagaattgcagtggagatgcagat
caatatggcaaccatcgatctccgagaatcgtttctttgaagcatcactggtggtggatg
atgaatactgtgtgggatggcttgccagagacaaggatgcactcgggacacatactcttc
attgaagaagatcatttcatttatccgaatgcttatcgaaatatccagcttctggtgaag
ctgaaaccggcgaaatgtcctgattgctttgctgtgaacttggctccatctgacgtgaag
tcaaagggagaagggtgggagagcttgatagcagagaaaatgggaaatattggctataca
tttaataggactgtttggaggaagatccatgcaaaggcgagggagttctgctggtttgat
gattataattgggatatcactatgtggtcaacagtttacccctcgtttgggactcctgtg
tacactttgagaggacctcgggcaagtgctgttcattttgggaaatgtgggttgcatcag
gggcaggataagattagtgcatgtattgataatggagaggcaaagtttgaattggagaac
gttgataaggttcctaatatcaacattgactggccagtctatgtattcaagaatcaagag
ggataccgtgcaggtttcaaaggatggggaggatggggtgatcatagagatcaggagctt
tgcttgagttttgcctacatgtatcactcttctgatgctttaaccaacggaagagatgct
tccaaacattcataa

DBGET integrated database retrieval system