KEGG   Dendrobium catenatum: 110094742Help
Entry
110094742         CDS       T05027                                 

Definition
(RefSeq) glutathione S-transferase DHAR3, chloroplastic
  KO
K21888  glutathione dehydrogenase/transferase [EC:1.8.5.1 2.5.1.18]
Organism
dct  Dendrobium catenatum
Pathway
dct00053  Ascorbate and aldarate metabolism
dct00480  Glutathione metabolism
dct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    110094742
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110094742
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dct02000]
    110094742
Enzymes [BR:dct01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.5  With a quinone or similar compound as acceptor
    1.8.5.1  glutathione dehydrogenase (ascorbate)
     110094742
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     110094742
Transporters [BR:dct02000]
 Other transporters
  Pores ion channels [TC:1]
   110094742
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_N_4
Motif
Other DBs
NCBI-GeneID: 110094742
NCBI-ProteinID: XP_020675705
Position
Unknown
AA seq 267 aa AA seqDB search
MASTVAATTSVFARSSTALNPNRVHLRFFAPRPCRPLGRFRFLPIRALSSPNGFFNPIEV
CVKESVTVPGKLGDCPFSQRVLLTLEEKNLPYDIKLANLANKPEWFLKISPEGKVPVAKL
DDKWIADSDIITQLIEEKCPEPPLAAPPEKSSVGSKIFSAFIAFLKSKDPNDGTEQALLT
ELTAINEYLKENGPFVNGEKISAIDLSLGPKLYHLEIVLDYYKSWSVPESLTFVRNYMES
VFSRESFVKTQALREDVIAGWRPKVEV
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgacagtggcggcaacgacctccgtctttgcccgctcctcgactgctctcaat
cccaatcgtgtccatctccgcttctttgctcctcgtccatgccgccctcttgggcggttt
cgctttctccccatcagagctctctcctctcccaacggcttcttcaaccccattgaggtc
tgcgtcaaggaatcggttacagttcccggaaagctcggtgactgccccttttcacagagg
gttctgttgactcttgaggagaaaaatctaccttatgacattaagctagctaatcttgct
aataagccagaatggtttctaaaaattagtcctgaaggtaaagttcccgttgctaaactt
gatgacaagtggattgctgattctgatattatcacgcaattaattgaagagaaatgtcct
gagccacctttggccgctcctcctgagaagtcttcagttggttcaaaaatattctcagcc
tttattgcttttcttaaaagcaaagaccccaatgatgggacagagcaagctttgcttaca
gagctgacagcgattaatgagtatctaaaagaaaatggtccttttgtgaatggtgaaaaa
atttcggcaattgatttgtcccttggacctaagctataccatttggagatagttcttgac
tattacaaaagttggtcggttcctgaatctcttacatttgtcaggaattatatggaatca
gttttctcaagggagtcttttgttaaaactcaagccctaagggaggatgtaatagctgga
tggagaccaaaagttgaagtttaa

DBGET integrated database retrieval system