KEGG   Dendrobium officinale: 110096666Help
Entry
110096666         CDS       T05027                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 3-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
dct  Dendrobium officinale
Pathway
dct00052  Galactose metabolism
dct00500  Starch and sucrose metabolism
dct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110096666
   00500 Starch and sucrose metabolism
    110096666
Enzymes [BR:dct01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     110096666
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 110096666
NCBI-ProteinID: XP_020678379
Position
Unknown
AA seq 580 aa AA seqDB search
MRSSKEVLPKCLLLILFAYILLEKNGVEASHRIASTEEHKNVPPATISNRTGYHFQAPKN
WINDPNGPMYYNGIYHLFYQFNPLQPVWGNIVWAHSYSTDMINWKPLQHAIYPTKPFDIN
GCWSGSATILPGNKPVIMYTGIDGQNRQVQNVAFPKNLSDPYLREWVKPDYNPVIKPEGE
INSSAFRDPTTAWYGPDSHWKTIIGSRKGRLGMAVLYKSRDFVKWVKAENPLHSSQNSGM
WECPDFFPVLPKPPMLGVDNSVTRNGLKHVFKVSLDETRYDYYTIGTYDFIHNKYVPNGL
SPDNNTGLRFDYGNFYASKTFFDEGKGRRVLWGWSNESDSTQDDWGKGWAGIQTIPRALW
LDGNGRQVVQWPIEEVNKLRKKEVGIRRKTVKSGRVIEVKGIEAAQADVEVSFDLSSSLD
KAEKFNLSWSDPQKLCGQKGAEEKGGIGPFGLYVLATDDREERTAVFFRIFKEGQKHVIL
MCQDPTKSSKRTGLYKPTYGGFVNYDLRKSGGKLSLRTLIDHSVVESFGAKGRTCITSRV
YPNFAVGSNACIFAFNNGAEDVKIIELTAWEIKRPLMNGI
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgagaagttctaaggaagttctacccaaatgtctgcttctgattctttttgcctatatt
ttgttggagaaaaatggagtggaggcttctcataggattgccagtacagaagaacacaaa
aatgttcctcctgcaactattagtaaccgcacaggttatcacttccaagccccaaagaac
tggattaatgatccaaatgggccaatgtactacaatggaatctaccacctcttctaccag
ttcaacccgttgcaacctgtttggggcaacattgtgtgggcccactcatactcgacagac
atgatcaactggaagccactccaacacgcaatttatcccacaaaacccttcgacatcaac
ggctgctggtccggctcggcaactattctcccgggtaacaaaccggtcatcatgtacaca
ggtattgacgggcaaaatcgacaggtgcagaacgtcgcctttccaaagaacctgtctgac
ccgtacctacgtgaatgggtcaaacccgattacaacccggtaatcaaacctgaaggcgaa
atcaactccagtgccttccgcgacccgactacggcgtggtatgggccggatagccactgg
aaaacgatcatcggcagccgcaaaggtcgtctgggaatggccgttctttacaaaagtcga
gattttgtcaaatgggtcaaggcagagaacccgttacactcgtctcagaactcgggtatg
tgggaatgccctgacttttttcccgtgttacccaaacctcctatgctgggtgtggacaat
tcggttacccgtaacgggttgaaacatgtgtttaaggtcagcttggatgaaaccaggtac
gattattacacgatagggacctatgatttcatccataacaaatacgtgccgaatggattg
tccccggataacaacacagggctgagatttgattacggaaacttctacgcttccaagact
ttctttgatgaggggaaggggaggagagttctgtggggttggtcgaacgagtctgatagt
actcaggatgactggggaaaggggtgggcagggattcaaacgattccgagagctctgtgg
ttggatggtaatggtaggcaagtagtgcagtggccgattgaagaggttaacaagctgagg
aagaaagaggtggggatacgtagaaagaccgttaagagtgggagagtgattgaggtaaaa
ggtattgaggctgcgcaggctgatgtagaggttagcttcgacttgtcttcaagcttggat
aaagctgagaaatttaatctgtcatggagcgacccacagaagctttgtggtcagaaagga
gcggaggagaagggcgggattggtccctttggactttatgttttggctacggatgacaga
gaggaaagaactgcagttttctttagaatatttaaggaaggacaaaagcatgtgattctt
atgtgccaagacccaaccaaatcttcgaagaggacaggcttgtacaagccgacatatgga
ggctttgtgaattatgatttgagaaagagtggtgggaagttatctctcagaactctgatt
gatcattcggtggtggagagctttggagcaaagggaagaacttgcataacgtcaagggtt
tatccaaattttgccgttggttcaaatgcatgtatttttgctttcaacaatggggctgaa
gacgtgaagataatagagcttacagcatgggagataaagaggcctttaatgaatggaatt
taa

DBGET integrated database retrieval system