KEGG   Dendrobium catenatum: 110096782Help
Entry
110096782         CDS       T05027                                 

Definition
(RefSeq) erlin-2-B isoform X1
  KO
K23341  erlin
Organism
dct  Dendrobium catenatum
Brite
KEGG Orthology (KO) [BR:dct00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dct04121]
    110096782
Ubiquitin system [BR:dct04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    110096782
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 Tap-RNA_bind
Motif
Other DBs
NCBI-GeneID: 110096782
NCBI-ProteinID: XP_020678522
Position
Unknown
AA seq 373 aa AA seqDB search
MQAQPPQPPPQPPPPQGTLPQPHQQQQNSQGQRNPPPSDADATTFLLLGIIFVAFAIIFL
STSFSTNWNFSVLHQVPEGYVGAYWRGGALLKTITNPGFHLKFPLVTEFEPIQVTIQTDL
VRDIPCGTKGGVMISFDKIEVVNRLNKGHVYDTLLNYGVNYDKTWIYDKIHHEINQFCSS
HSLQQVYIDMFDQIDDKMKEALQMDCTQYAPGVEIISVRVTKPNIPAIIKRNFELMEEER
TKALIAIEAQKVAEKEAETQKKIALSEAEKNAQVSKILMEQKLMEKDSSKQQEAIENEMY
IAREKSQADANFYRVMKEAEANKLKLTPEFLELKFIEAIANNSKIFFGEKVPNMVLDQRL
LGNFLNGFAKKDL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgcagccgcctcaacctccaccacagccgcctccaccacaggggactctacca
cagccgcaccagcagcagcagaatagtcagggtcaacgaaatcccccgccgtcggatgcc
gatgctacgacgtttctgctgttgggaatcatctttgtcgctttcgcgataatttttctt
tcgacctcattctcaacaaactggaatttttctgtgttacatcaagtccctgagggttat
gttggtgcatactggaggggcggtgctttattgaaaacgatcactaatccaggctttcat
ctcaaatttccactagtcacggaatttgagcccatccaagtgaccattcaaacagatctg
gtaagagatattccttgtggaacaaaaggtggagtaatgatcagctttgataagatagag
gttgtaaatcgccttaataagggacatgtgtatgacactcttctcaattatggtgtaaac
tacgataagacatggatatatgataagattcaccatgagatcaatcaattctgtagctct
cattctttgcagcaagtgtatattgatatgttcgatcaaattgatgacaaaatgaaagaa
gctcttcaaatggactgcacgcagtatgccccgggggttgaaattatcagcgttcgtgtt
acaaaacccaatattcctgcaattattaagcgcaattttgaacttatggaggaggaacgc
actaaggctttaattgccatagaggcacaaaaggttgcagaaaaagaagctgagacccaa
aagaagatagccttatccgaagcagagaagaatgcccaagttagcaagattctcatggag
caaaaattaatggaaaaagacagctcaaagcagcaagaagcaatcgagaatgaaatgtac
attgctcgtgagaaaagccaagcagacgctaatttttacagggtgatgaaggaagcagag
gctaataaactgaaacttacacctgagtttcttgaactcaaattcattgaagccattgca
aacaactcaaaaattttctttggagagaaggttcctaacatggttttagatcaaaggctc
cttggtaattttcttaatggatttgctaagaaggatctttga

DBGET integrated database retrieval system