KEGG   Dendrobium catenatum: 110098431Help
Entry
110098431         CDS       T05027                                 

Definition
(RefSeq) succinate-semialdehyde dehydrogenase, mitochondrial
  KO
K17761  succinate-semialdehyde dehydrogenase, mitochondrial [EC:1.2.1.24]
Organism
dct  Dendrobium catenatum
Pathway
dct00250  Alanine, aspartate and glutamate metabolism
dct00650  Butanoate metabolism
dct01100  Metabolic pathways
Module
dct_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:dct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    110098431
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110098431
Enzymes [BR:dct01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     110098431
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 110098431
NCBI-ProteinID: XP_020680925
Position
Unknown
AA seq 522 aa AA seqDB search
MALLRVALARCHLPASSCLLPRFTRCQMGTVTQQPAVSVNRLRESGLLKTQGLIGGKWVD
AYDGKTIKVENPATGELIANVPFMGKKEAGDAISSAYSTFNSWSKLSASERSKCLRKWYD
LLLAHKDDLALLITLEQGKPLKEALGEVAYGASFIEFFAEEAKRTYGDVIPPTQNDRRLL
VLKQPVGVVGAITPWNFPLAMIARKAGPALASGCTIVVKPSEYTPLTALAAAELALQAGI
PPGALNVVLGNSSEIGDALLESTQVRKLTFTGSTAVGKKLMAGSANTVKKVSLELGGNAP
CIVFDDAEIDVAVKGSLAAKFRNSGQTCVCANRILVQEGIYEKFANAFSEAVKNMQVGNG
LDEGVAQGPLINEAAVEKVERLVKDATSKGANIVLGGKRHSLGMTFYEPTVIGNANNEML
VCREEVFGPVAPLLRFKTEDEAIRIANDTNAGLAAYIFTQCIPRSWRVSEALEYGLVGVN
EGLISTEVAPFGGVKQSGLGREGSKYGMDEYMELKYVCFGNI
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggcacttctccgcgtggctctcgctcgatgccacctgcctgcttcttcttgcttgctc
cctcgcttcacccgttgccagatgggtaccgtaacacaacaacccgctgtttcagtcaat
cgcctgagggagtccgggctactgaagacgcaaggtctcatcggagggaagtgggtcgac
gcttacgatggaaagactatcaaggtggaaaaccctgctactggtgaacttattgcaaat
gttccattcatgggcaaaaaggaagctggagatgcaatctcgtcagcttacagtactttc
aattcttggagcaaactcagcgcaagtgaaaggagcaagtgtcttagaaaatggtatgat
ctattacttgcccacaaggatgaccttgcgttgcttataacattggagcaaggaaagcct
ctgaaggaggcactgggtgaggttgcatatggagccagcttcattgagttttttgctgaa
gaggcaaaacgaacatatggtgatgtcatcccacctacacaaaatgatcgccgattactt
gtattaaaacagcctgttggggtggttggagcaattactccttggaactttccgctggcc
atgattgcacggaaggctgggcctgccttggcttctggttgcacaatagttgttaaacca
tcagagtatactcctttgaccgcattggctgcagctgaacttgcgcttcaagctggaata
ccacctggtgcactaaatgtggttctgggaaattcttctgaaattggcgatgctctattg
gaaagcacgcaggtgaggaagctcacgttcactggttcaacagctgttgggaagaagcta
atggcaggctcagcgaatactgttaaaaaggtgtcattggagcttggcgggaatgcccct
tgcattgtttttgatgacgcagaaatagatgtggcagtaaaaggaagtcttgcagcaaag
ttccgcaacagtggacaaacatgtgtttgtgcaaacaggattttggtccaagaaggcatc
tatgaaaaatttgcaaatgctttctcagaggctgttaagaacatgcaggttggcaatggg
cttgatgaaggtgtcgctcagggaccattgatcaatgaagctgctgttgagaaggttgag
agattagtcaaagatgctacctccaagggagctaacattgttcttggtgggaagagacac
agtctcggcatgacattctacgaacctaccgttattgggaatgcaaataatgaaatgctc
gtatgtagggaggaagtatttggtccagttgctcctcttttgcgctttaaaactgaagac
gaggctattcgcatagcaaatgacacaaatgctggtctggctgcttacatatttactcaa
tgcatacctcgttcatggcgtgtatcagaagcacttgaatatgggcttgttggagttaat
gaaggcttaatatctactgaggttgcaccatttggaggtgtcaagcagtctggccttgga
cgagaaggctccaaatatggcatggatgaatatatggagctcaaatatgtgtgctttgga
aacatttag

DBGET integrated database retrieval system