KEGG   Dendrobium catenatum: 110098519Help
Entry
110098519         CDS       T05027                                 

Definition
(RefSeq) cyclin-dependent kinase F-4
  KO
K08829  male germ cell-associated kinase [EC:2.7.11.22]
Organism
dct  Dendrobium catenatum
Brite
KEGG Orthology (KO) [BR:dct00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dct01001]
    110098519
Enzymes [BR:dct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     110098519
Protein kinases [BR:dct01001]
 Serine/threonine kinases: CMGC group
  RCK family [OT]
   110098519
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH
Motif
Other DBs
NCBI-GeneID: 110098519
NCBI-ProteinID: XP_020681036
Position
Unknown
AA seq 458 aa AA seqDB search
MERYLVIKEVGFGTFGNVWRAVNKDSGEIVAIKKMKKKYYCWEECMNLREVKSLRKMNHP
NVVKLKEVIREHDVLYFIFEYMECNLYQFMNDRDKPFLESEIRNWCFQVFQALAYMHQQG
YFHRDLKPENLLVSEDVIKVADFGLAREISSRPPFTEYVSTRWYRAPEVLLQSSVYGPAV
DIWAMGAIMAELFNLRPLFPGTNEADEIQKICSVIGSPCQNSWAEGLRLADTIKFQFPQY
TGIHLSMLIPSASDCAINLISSLCSWDPLRRPTAAKALQHPFFKPCYYIPPSLRLLDSGN
SKTLVSAPEHLSARRCSVGALNNKPPSNVPSPTACTSLKTGAAQRKIDIHLYQDYIPYEN
RAVQPLYRRPAWNNPGHLGTVAHGAWDFNENLVHPMVSSGGVDDMTDKLAKLAMNSGSQS
VRPSPPALKAGRWHSNTRYLNRSYEIPPVRVYPRNAVG
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctatctggtgatcaaggaagttggatttggaacatttggtaatgtctggaga
gctgttaataaagatagtggtgaaattgttgccataaagaaaatgaagaaaaagtattat
tgctgggaggagtgcatgaatcttcgggaagtcaagtcccttcgaaaaatgaaccatcct
aatgttgtgaagcttaaagaggtcattagagagcacgatgtgctatactttatctttgaa
tatatggagtgcaatctttatcagtttatgaatgatagagacaagccttttttagagtct
gaaattcgaaattggtgctttcaagtgttccaagcccttgcatacatgcatcagcaaggc
tattttcaccgtgaccttaagcctgaaaatttattggtgtctgaagatgtgatcaaagtg
gcggactttggcctagctcgtgaaatttcgtcaaggccaccatttacagaatacgtctcc
actcgttggtaccgagcccctgaagttttgctgcagtcttctgtatatggccctgcagtt
gatatatgggccatgggtgcaataatggcagagctgtttaatctccgccctctttttcct
ggcacaaatgaagcagatgaaattcaaaaaatctgcagtgtgattggctctccttgtcaa
aattcctgggctgagggactacgcctcgcagatacaataaagtttcagtttccacagtat
acgggcatccacctctcgatgttgatcccatccgccagtgactgtgctatcaacctcatc
tcatcactttgttcatgggatcctctccgaaggcctaccgctgcaaaggctcttcagcat
ccgttctttaagccttgctactacatcccaccatctcttcgtctgcttgactctggaaat
tctaagacacttgtgtccgctccagaacatttgagtgcgagaaggtgctctgttggagct
ttaaacaataagcctccaagtaatgtgccatcaccaactgcatgcacctctttgaagacg
ggtgctgcccagaggaagatagatatccatctgtatcaggattatattccttacgaaaat
cgtgcagtgcaaccactgtataggcgaccagcttggaataatccaggacacctcggcaca
gtagcacatggggcctgggattttaatgagaacttggtgcatcctatggtaagctcaggt
ggagttgatgatatgacagataagctggcaaaacttgccatgaattctggttcccagtca
gtgaggccgtcaccaccagcattgaaagctggcagatggcattccaacacacgctatctt
aaccgatcttatgagataccccctgttagagtttatccacgcaatgctgttggctga

DBGET integrated database retrieval system