KEGG   Dendrobium catenatum: 110100287Help
Entry
110100287         CDS       T05027                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
dct  Dendrobium catenatum
Pathway
dct03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:dct00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110100287
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dct03041]
    110100287
Enzymes [BR:dct01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     110100287
Spliceosome [BR:dct03041]
 Complex C
  Other components
   Step II factors
    110100287
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C DEAD AAA_22 AAA_30 DUF2075 AAA_19 ABC_tran HA2 cobW PhoH Sigma54_activ_2 AAA_16 AAA_14 AAA_29 Helicase_RecD AAA_23 T2SSE Flavi_DEAD ATPase_2 DAP3 AAA_33 FtsK_SpoIIIE NB-ARC Sigma54_activat MMR_HSR1 RsgA_GTPase DUF87
Motif
Other DBs
NCBI-GeneID: 110100287
NCBI-ProteinID: XP_020683383
Position
Unknown
AA seq 430 aa AA seqDB search
MAVLPILRFEDKIVEAVEKNPVVVIIGETGSGKSTQLSQILHRRGYTRSGAIAITQPRRV
AAVSVSRRVALEVGAQLGEEVGYAIRFEDRTSDKTCIKYLTDGVLLRESLSNPRLDQYSV
IILDEAHERSLNTDILLGLMKRLVKMRSSNLKVLITSATLDGVKVSKFFSDCPILNVPGQ
LFPVEKLYSSERPKNYIDSSMRTALDIHSRELPGDILIFMTGQDEIDKMVSKLEEKIQNL
EEGSCMDALVLPLHGSLPPEMQVRVFSPAPQNCRRIIVATNIAETSLTVDGIVYVIDTGY
VKQRQYNPSTGMYSLDVVQISRVQADQRAGRAGRTCPGKCYRLYPSSVYYEEFLDATVPE
IQRSSLTGSVLYLKSLNLPDIDILKFDFLDSPSRESLADALRQLYLIDAIDENGMITHVG
RTMAGNTFIF
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggctgttcttccgattcttcggttcgaagacaaaatagtggaggccgtggagaagaat
cccgtggtcgtgattattggagaaactggctccggaaaaagcactcagctgtctcagatt
ctacaccgcagaggatacacgcgatccggagcaatcgcaatcacccaacctcgcagagtt
gctgctgtatccgtttcgaggagggttgctttagaagttggtgcacagcttggtgaagaa
gtgggctatgccattcggtttgaagatcgaacatctgataaaacttgcatcaagtatctc
actgatggtgttcttctccgtgaaagcctctctaatcctagattggatcaatattcagtc
ataattcttgacgaagctcatgagagaagcttaaacactgacatattacttgggttgatg
aaacgtttggtcaagatgcgctcttcaaatttaaaagttcttattacttcagcaacttta
gatggagtgaaagtatcgaagttcttctcagactgtcccatattgaatgttcctggacaa
ttatttcctgtagaaaagttatacagttccgaacgccctaaaaactatattgattcatcc
atgagaactgctcttgacatacactctcgtgaactaccaggagacatccttatatttatg
acaggacaggatgagattgacaaaatggtatccaagttggaggaaaagattcaaaacctt
gaggaaggttcatgtatggacgccctagtccttccacttcatggctctttaccacctgag
atgcaggttcgtgtattcagtccagcacctcaaaattgtaggcggattattgtcgccaca
aatattgctgaaacatcattgacagtggatggcattgtatatgtcattgatactggttat
gtgaagcagcgtcaatataatccatcgactgggatgtattctcttgatgttgtccagatt
agcagagtccaagctgatcagcgtgctggccgagctggaagaacttgtcccggaaagtgt
tatagattatacccctccagcgtctattatgaagagttcctcgatgctaccgttcctgaa
attcagaggtcatctttgaccggaagtgtcttataccttaaatcacttaatcttccagat
attgatatcttgaagtttgattttcttgattcaccatcacgtgagtccttagccgatgct
ttaaggcagttatatctcattgatgctattgatgaaaatggaatgataactcatgtggga
cggactatggcaggtaacaccttcatattttga

DBGET integrated database retrieval system