KEGG   Dendrobium catenatum: 110100660Help
Entry
110100660         CDS       T05027                                 

Definition
(RefSeq) pyruvate decarboxylase 1
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
dct  Dendrobium catenatum
Pathway
dct00010  Glycolysis / Gluconeogenesis
dct01100  Metabolic pathways
dct01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110100660
Enzymes [BR:dct01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     110100660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C Bac_rhamnosid_N
Motif
Other DBs
NCBI-GeneID: 110100660
NCBI-ProteinID: XP_020683921
Position
Unknown
AA seq 602 aa AA seqDB search
MENTVGSVDALAKAAGNVGLGGAPATHCHPVEPAAPAGEATLGRHLARRLVQIGIRDIFT
VPGDFNLTLLDHLIAEPGLNNIGCCNELNAGYAADGYARANGVGACVVTFTVGGLSVLNA
IAGAYSENLPVICIVGGPNTNDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAAVNNLDD
AHELLDTAISTALKESKPVYISISCNLPAIPHPTFSHEPVPFYLSPRLSNQMGLECAVAA
TAEFLNKAVKPVLVGGPKLRVAKAGEAFVELADACGYPVAVMPSAKGLVPENLPRFIGTY
WGAVSTAFCSEIVESADAYLFAGPIFNDYSSVGYSLLLKKEKSIIVQPDRVIVANGPAFG
CILMKDFFHALAKRLKKNTTAHENYCRIFVPEGHPLESKPKEPLRVNVLFKHIQSMLSGT
NAVIAETGDSWFNCQKLKLPEGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVLAFIGDG
SFQVTAQDVSTMIRCGQNTIIFLINNGGYTIEVEIHDGPYNVIKNWNYTALVDAIHNGEG
KCWTTKVLYEEDLKAAIETATGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPN
PQ
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atggagaacaccgtcggatcggtggacgccctggcgaaggcggccgggaacgtcgggctg
gggggcgctccagccacgcactgccatccggtggagccggcggctcccgccggggaggcg
acgcttggccgccacctggcgcgtcgcctggtccagattggcatccgtgacatatttacg
gttcccggcgacttcaaccttaccctcctcgaccaccttatcgctgagccggggctcaat
aacatcggatgttgcaacgagctaaacgctgggtacgccgccgatggctacgctcgcgcg
aacggtgtcggtgcctgcgtcgtcacgttcaccgtcggcggcctcagcgtccttaatgct
atcgctggcgcatacagcgagaatctccctgttatctgcatcgtcggcggccctaatacg
aatgattacgggactaatcggatcctgcatcacaccatcggtctcccagatttctctcag
gagcttcgatgctttcagaccgtcacctgctatcaggcggcggtgaataatttggatgat
gctcacgagctcctcgacacagcgatctccactgctctcaaggagagcaagccggtttac
atcagcatcagctgtaatcttcccgctatcccccatccaacctttagccacgagccggtc
cccttctaccttagtcccagattgagcaatcagatgggtctagagtgcgcggtggctgca
actgctgagttcttgaacaaggcggtgaaaccggtgctagtcggcgggccaaaactgagg
gtggctaaggccggagaagctttcgtcgagcttgctgatgcatgtggctatcctgtagct
gtgatgccgtccgcaaagggtttagtaccagaaaacctccccaggttcattggcacctat
tggggcgcggtcagcacagcgttctgctcagaaattgtggaatctgcagatgcctatctc
tttgcaggtccaatctttaacgactacagctccgtcggttactcccttctcctcaagaag
gagaaatccatcattgttcaacctgaccgagttatcgtggccaatggcccggcttttggc
tgcattcttatgaaggatttcttccatgctttggccaagaggctcaagaagaacacaaca
gcccatgagaactactgcaggatctttgtgcctgagggtcatccccttgagtccaagccc
aaggagcctctgcgtgtgaatgttctcttcaagcacattcaaagcatgctctctggtacc
aatgccgtgattgctgagactggagactcgtggttcaactgccagaagctcaagttaccg
gagggttgcgggtacgagttccagatgcagtatggctccattggctggtctgttggcgcc
acccttggctacgcccaagctgccaaggataaacgtgtcctcgccttcattggtgatgga
agctttcaggtcacagctcaggatgtgtcaacaatgataaggtgtgggcagaacaccatc
atattcctcatcaacaatggaggttacaccattgaggtcgagatccatgatggaccttac
aatgtgataaagaactggaactatactgcattagtggatgccatacacaacggggagggg
aaatgctggaccacgaaggtgctgtatgaggaagatctcaaggcggcgattgagaccgcg
actggagctaagaaggattgcttgtgcttcatagaggtgatagtgcacaaggatgatacg
agcaaagagcttcttgaatggggttccagagtctctgcagccaacagcaggccaccaaat
cctcagtaa

DBGET integrated database retrieval system