KEGG   Dendrobium catenatum: 110101297Help
Entry
110101297         CDS       T05027                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dct  Dendrobium catenatum
Pathway
dct00010  Glycolysis / Gluconeogenesis
dct00562  Inositol phosphate metabolism
dct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110101297
   00562 Inositol phosphate metabolism
    110101297
Enzymes [BR:dct01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     110101297
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     110101297
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 110101297
NCBI-ProteinID: XP_028556361
Position
Unknown
AA seq 521 aa AA seqDB search
MTLYVSVTLVFLLLFYFCSSLSAAATSFATDESFDVRQHLSTVSRYGAGKETTIGSYVPS
TIPEGCNPIHLNLVARHGTRSPTKKRIKELDQLAIHLDELLNEAKRGEKSLPQKIPSWLS
GWQSPWKGRLKGGELIIKGEDELYHLALRIRKRFPELFNEEYHPDIFSIRATQVPRASAS
SVAFGIGLFQGNGTLGPGMHRAFSVTSESRASDVCLRFYDTCETYKEYRRSQEPAVDKLR
EPILEEITAELVKRYQINFTRQDVASLWFLCKQEASLLDITDQACNLFTTSEVELLEWTD
DLELFLLKGYGKSINYHMGLPLLQDVVQSMEQAILAKEENHKPGTFEKARLRFAHAETVV
PFTCLLGIFLEGSEFEQMQRDEPLSLPPKPPLPRRWRGSTVAPFGVNNMLVLHQCPGNAS
HSISASKGYKSEYYVQVLHNEIPVPMPGCYNADFCSFQVFKESIVNPHLKHTFESVCTAQ
AKEEFPSPKPSSIACKLLNFIRSFFQRDSYGNTKINQKNEL
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgactctctacgtgagcgttacccttgtcttccttctcctcttctacttctgctcctct
ttgtccgcggccgctacctcctttgctaccgatgagagcttcgacgttcgccagcacctc
tccaccgtctccaggtacggagctggtaaagaaactacaattggttcttatgttccttcc
actatcccagaggggtgtaatcctatccacttaaatctagtggcaaggcatggaactcgt
tctcccaccaagaagcggattaaagagttggatcaattggcaattcatttagatgaactg
cttaatgaagcaaaacgtggagaaaagagccttccgcagaaaattccatcctggttgtct
ggttggcaatctccctggaaaggcagactgaaaggtggggagctaataattaaaggagaa
gacgaactttatcatctagctttaagaatacggaaaagatttccagaattgttcaacgag
gaatatcatcctgatatattctcaataagagcaactcaggttcctcgtgcatcagctagt
tctgtggcatttggaattggtctttttcaaggaaatggaaccttagggcccgggatgcat
agagcattttctgtgacgagtgagagccgtgcaagtgatgtatgtctacggttctatgat
acttgtgaaacttataaggaataccggagaagtcaggaacctgcggttgataagctcaga
gagccaattttggaggaaattactgctgagcttgtcaaacgttatcaaattaatttcact
agacaagatgtggcttcactttggtttctctgtaagcaggaagcttctttgttggacatt
actgaccaagcttgtaacctgtttactacttccgaggttgaattacttgagtggacagat
gacttggagttgtttttattaaaaggttatggtaaatcaataaactatcacatgggactc
ccattgcttcaagatgttgttcagtcaatggagcaagcaattttggccaaagaagaaaac
cataaacctggaacttttgagaaggcgaggctcagatttgctcatgctgaaacagttgtg
cctttcacctgtcttcttgggatttttcttgaagggtccgaatttgaacaaatgcaacgg
gacgagccattaagtttgccaccaaaacctcctctaccaagaaggtggaggggaagtact
gtcgcgccttttggtgtgaataatatgttggttttgcaccaatgtcctggcaacgcttcg
catagcatcagtgcaagcaaaggctacaaaagcgagtactatgtgcaggttctgcacaac
gaaattccagttcccatgccgggctgctacaacgcagatttctgctctttccaggttttc
aaggaaagcatcgtcaatccccatctaaagcataccttcgaatcagtctgcactgcacag
gcaaaggaggaattcccatcgccaaaaccgagttccattgcatgcaaactcttgaatttt
atacgcagcttcttccaaagagattcatatggaaacactaaaattaaccaaaagaacgag
ctatga

DBGET integrated database retrieval system