KEGG   Dendrobium catenatum: 110102652Help
Entry
110102652         CDS       T05027                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase CYP26-2, chloroplastic-like
  KO
K03768  peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC:5.2.1.8]
Organism
dct  Dendrobium catenatum
Brite
KEGG Orthology (KO) [BR:dct00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dct03110]
    110102652
Enzymes [BR:dct01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     110102652
Chaperones and folding catalysts [BR:dct03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    110102652
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 110102652
NCBI-ProteinID: XP_020686746
Position
Unknown
AA seq 313 aa AA seqDB search
MKTLIPSLSSPPHALLPSSPPPSPLPPIISRRLAITLSLSLSSLTFPFPSLSAVLPSPCP
SSAAVTSKAFLDISIADKPAGRIIIGLFGAASPAAATRFASLASGSAGVSFRRKEFIKIA
PTFVQHAGVRSYGIDADLARRGSGMDLAADELISEWAAEADRCAGLRSTAGTVGIVVRNP
ARSAPATRIVARNGRIEVEEEGEVGPNGTEFVIATRDSPEMDEAAVAVGRVIDGMDVVEK
IAGVSAVRDNTGSPYFRLHSGGNYYALFRKKLLHAVIKLFGGISECAMSSSTQYRYTIKS
DVTRSNSPPNGIQ
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgcttatcccctccctctcatctccaccgcacgcgcttctcccctcctctcct
ccgccgtcgccgttgccgccgatcatctcccgccgtctcgccatcaccctctccctctct
ctctcctccctcacctttccctttccctctctttccgccgttctcccttccccctgccca
tcctcagccgctgtaacatccaaagccttcctcgacatttccattgccgacaaacccgcc
ggccgcatcattatcggcctctttggcgctgcctcacccgccgccgcgacaagattcgcc
tctctggcgtccggctccgccggcgtcagcttccggcggaaagagtttatcaagatcgcc
cccaccttcgtccaacacgccggcgtccgatcctacggcatcgacgctgatctcgcgcgc
cggggttccggcatggacctcgccgccgacgaactcatctctgagtgggcggcggaggcg
gatcgatgtgcgggcttgagaagcacggcgggaacggtggggatcgtggtgaggaatccg
gcaagatctgcgcctgcaacccgaatcgtggctaggaatgggcggattgaggtggaagaa
gagggtgaggtggggcccaacgggacggagtttgtgattgcgacaagggattcgccggaa
atggatgaggcggcggtggcggtcgggagggtcattgatgggatggacgtggtggagaag
atcgccggcgttagcgcggtgagagataatactggatcgccatacttcaggcttcattca
gggggaaattattacgctttattcagaaagaaattattacatgcagtcatcaaactcttt
ggtggcatatcagaatgcgccatgtcatccagtacacagtaccgatacacaataaaaagt
gacgtgacccgttctaattcgcctccgaacggtatccagtga

DBGET integrated database retrieval system