KEGG   Dendrobium catenatum: 110103270Help
Entry
110103270         CDS       T05027                                 

Definition
(RefSeq) nucleoside diphosphate kinase 3-like
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
dct  Dendrobium catenatum
Pathway
dct00230  Purine metabolism
dct00240  Pyrimidine metabolism
dct01100  Metabolic pathways
dct01110  Biosynthesis of secondary metabolites
dct04016  MAPK signaling pathway - plant
Module
dct_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
dct_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
dct_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:dct00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110103270
   00240 Pyrimidine metabolism
    110103270
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    110103270
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dct04131]
    110103270
Enzymes [BR:dct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     110103270
Membrane trafficking [BR:dct04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    110103270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK PSI_PsaJ HH_signal
Motif
Other DBs
NCBI-GeneID: 110103270
NCBI-ProteinID: XP_020687572
Position
Unknown
AA seq 236 aa AA seqDB search
MSYQICRSASRAVRSLLSASKSSPILFEGRAIAATTVNKSRGRYSTLSSLYVGASYKSTY
GGWLPAALALPAAVYMLQEEVHAAELERTFIAIKPDGVQRGLIAEIISRFERKGYKLVAI
KLVVPSNEFAQQHYHDLKERPFFSGLCDFLSSGPVLAMVWEGEGVIKYGRKLIGATDPQK
SEPGTIRGDLAVVVGRNIIHGSDGPETAKDEIALWFSPTELISYANNAEKWIYGVN
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagctaccagatctgcaggtcggcttcgagggctgtgaggtccctcctctcggcttct
aagagctcgccgatcctctttgagggacgagctattgcagcaactacagtaaacaaatca
agaggaaggtattctactttgtcctccctttatgtgggtgccagttacaagagtacatat
ggtggatggttacctgctgctctggctcttccagctgcagtgtacatgcttcaggaggag
gttcatgcagctgagttagaaaggacttttatcgcaataaagccagatggagtccaaaga
ggcctgatagcagagataatttcacgtttcgaacgcaaagggtataagctggtagctata
aaattggtagttccttccaatgagtttgctcagcagcattaccatgatctcaaggagagg
cctttctttagtggcttatgtgactttctgagctcgggtcctgtacttgccatggtttgg
gaaggggagggagttataaagtatggtagaaaacttattggtgcaacagacccacaaaaa
tcagagccgggaaccatccgaggtgatcttgcggttgttgttggaagaaacataatccat
ggaagtgacggacctgaaacggctaaagatgagattgccctctggttttcacctaccgaa
cttatttcttacgccaacaatgcggagaagtggatctatggagttaattga

DBGET integrated database retrieval system