KEGG   Dendrobium catenatum: 110103323Help
Entry
110103323         CDS       T05027                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
dct  Dendrobium catenatum
Pathway
dct03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:dct00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110103323
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dct03041]
    110103323
Enzymes [BR:dct01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     110103323
Spliceosome [BR:dct03041]
 Complex C
  Other components
   Step II factors
    110103323
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 AAA AAA_19 AAA_14 T2SSE AAA_30 Flavi_DEAD AAA_16 ABC_tran DUF2075 AAA_33
Motif
Other DBs
NCBI-GeneID: 110103323
NCBI-ProteinID: XP_020687646
Position
Unknown
AA seq 1112 aa AA seqDB search
MAAGAEDSIKKLEYFSIVSKVRTELESHLGCGDKILADFITELGRNAKSVEEFDAKVKES
GGEIPNYLLRTLLAIIHSILPSNKKYAAFRVDDRQRFKDEIEKEVRDREYRYDQVSDRGR
SIRIDDYSNHRAYSHERDDGTRHERTRSSGGRNFDEPELYQVYKGKVLRLMDNGCFVELS
DFSGKEGLVHVSQIANRRVANANEQVKLGQDVYVKVISVSGKNLSLTMRDVDQNTGKDLL
RLRKSTEDDALRTNPSSGNSTPIVRKGLSGITIVEDDNNASSRRPLKRMSSPEKWEEKQL
IAAGVLDVREYPTFDEEGDGLLYQEKRAEEELEIELNEAEPAFLQGQSRFSIDMSPVKIF
KNPEGSLSREAALQSALIKERREVRDQQQRTMLDSIPKDLNRPWEDPMPETGERHLAQEL
RGVGLSAYDMPEWKKDAYGKALTFGQRSKLSIQDQRQSLPIYKLKKELIQSVHDNQVLVV
IGETGSGKTTQVTQYLAEAGYTTRGKIGCTQPRRVATTSVAKRVAEEFGCRLGEEVGYSI
RFEDCTGPETVIKYMTEGMLLREILVDENLSQYSVIMLDEAHERTINTDVLFGFLKQLVK
RRPELRFIVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPESDYLDASLITVLQ
IHLTEPEGDILVFLTGQEEIDHACQSLYERMKGLGKNVPELIILPVYSALPSEMQSRIFE
PAPLGKRKVVVATNIAEASLTIDGIFYVIDPGFAKQNVYNPKQGLDSLVITPISQASAKQ
RAGRAGRTGPGKCYRLYTENAYRNEMSPSTIPEIQRINLGTTALNMKAMGINDLLHFDFM
DPPSPQALISAMERLYSLGALDEEGLLTKVGRKMAEFPLDPPLSKMLLASVDLGCSDEIL
TIIAMIQTGNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENF
IQSRSLRTAQDVRKQLLTIMDRYKLDVVSTGKNFTKIRKAITAGFFFHAARKDPQEGYRT
LVENQPVYIHPSSALFQRQPDWVIYHELVMTTKEYMREVTVIDPKWLVELAPRFYKSSDP
TKMSKRKRQERIEPLYDRYNEPNSWRLSKRRA
NT seq 3339 nt NT seq  +upstreamnt  +downstreamnt
atggcggccggggccgaagacagcattaagaagctggagtatttctcgatcgtttcgaag
gtgcgaacagagcttgaaagccatctggggtgcggcgataaaattctggccgacttcatc
accgaacttggccggaacgccaaatccgtcgaagaattcgacgccaaggtgaaagaaagc
ggaggggaaattcccaattacttacttcgaacccttctggccatcatacattcaatatta
ccctcgaataagaaatatgcggccttccgtgtcgacgaccgccaacgcttcaaggatgag
atcgagaaggaagttcgcgaccgtgagtacaggtacgatcaagtcagtgatagaggtagg
agtattagaatagatgattacagcaaccatagagcttatagtcacgaacgtgatgatggc
acgaggcatgagagaacccgttctagtggtggaaggaattttgatgaaccggagctctat
caggtttacaagggaaaggtattgcgcctgatggacaacgggtgctttgttgaattatct
gatttcagcgggaaggagggacttgttcatgtttcacagattgcaaatagaagagtcgcc
aatgcaaatgaacaggtgaagcttggtcaggatgtatatgttaaggtgatctcagtttct
ggcaaaaatcttagtctaaccatgagggatgtggatcaaaacaccgggaaggatctcctg
cgattaaggaagagcacagaggatgatgctttaaggaccaacccctctagtgggaacagt
acccctattgtaaggaaaggtctttcaggcattaccattgttgaggatgataataatgca
tcatccaggagaccattgaaaaggatgagctcgcctgagaagtgggaagagaagcagctg
attgcagctggtgttctggatgtgcgtgaatatccaacgtttgatgaagagggggatgga
ctcttgtatcaggaaaaacgtgctgaagaagaacttgagattgaactcaatgaagccgaa
cctgcttttttgcaaggccagagtcggttttccattgacatgtctcctgtaaagatcttc
aaaaatccagagggttctttaagcagggaagcggctcttcagtctgctctcatcaaggag
cggagagaagttcgtgatcagcagcagagaactatgcttgattccatcccaaaagatctc
aatcgaccgtgggaagatccaatgccggagacaggggagaggcaccttgcacaggagctg
agaggtgtaggattgtctgcttatgacatgccagaatggaagaaagatgcatatgggaaa
gctttgacatttggccagagatcaaagctttcaatacaagatcaaaggcagagtcttcca
atctacaaattgaagaaagaactgattcagtctgttcatgataaccaggtattggttgtc
attggtgagactggctctgggaagacaacgcaggtgactcaatacctggccgaggcaggt
tatactacaagaggaaagattgggtgcacacaaccccgtagggtggcaacaacgtcggtt
gcaaaaagggtggctgaggagtttggttgtcggttaggtgaggaagttggttattctatt
cggtttgaggattgcactgggccagaaactgtgataaaatatatgacagagggcatgctt
ctgagggaaattttggttgatgaaaacctttcacaatattctgttatcatgctcgatgaa
gctcatgagaggacaatcaacacagacgtgctctttggttttctaaaacaacttgtgaaa
cgaaggcctgaacttcggtttattgtcacttcagccacactagatgcagagaagttctct
gggtatttcttcaactgcaatatcttcacaattcctggcagaacatttcctgttgagata
ctctatacaaagcagccagaaagtgattatctagatgcatcactgatcacagttttgcag
attcacttaacagaacctgaaggagacattcttgttttcttgactggtcaagaagagatt
gatcatgcttgtcaatctctttatgagagaatgaaaggtctgggtaagaatgtgccggaa
ctgattatcttgcctgtgtatagtgctcttcccagtgaaatgcaatctaggatttttgag
cctgctccccttggtaagagaaaagttgttgtagctactaatattgcggaggcttcattg
acaattgatggaatattttatgtcattgaccctggctttgctaagcaaaatgtgtacaac
cctaaacaagggcttgattccttggtgatcactcctatatctcaagcatcagctaagcaa
agagctggtcgtgcaggacgtactggcccagggaagtgttatcgtctctacacagagaat
gcctatcgcaatgaaatgtcaccttccacaattccagaaattcagaggattaatcttggg
acaacagcattgaatatgaaggctatgggaattaatgatctcttacattttgattttatg
gatcctccatcgcctcaggcccttatatctgccatggaacggttgtacagtctaggagct
ttagatgaagaggggcttttaactaaagtagggagaaaaatggcagagtttccattggat
ccaccattgtctaagatgctacttgctagtgtggaccttggatgcagtgatgaaatcctg
accatcattgctatgatccagactgggaatattttctacagaccaagggagaagcaagcc
caagcagatcaaaagcgagccaagtttttccagccagaaggagaccacttaactttgctt
gctgtttatgaggcttggaaagctaagaatttttctggtccatggtgttttgagaacttc
atacagtcccgttctcttaggacggctcaggatgttagaaagcaactcctcactattatg
gataggtacaaattggatgttgtcagtactggtaaaaacttcacaaagataaggaaggct
attaccgccggattcttctttcatgctgcaagaaaagatcctcaagaaggttacagaacc
ctagtggagaaccaaccagtctacattcatcccagcagtgctctctttcaaaggcagcca
gattgggtcatatatcatgagcttgtcatgacaacaaaggagtacatgcgcgaagttact
gttattgatcccaaatggcttgtagaactcgcacctaggttttataaatcgtcagatcca
acaaagatgagcaagcgaaagcgtcaagagcgaattgagccactctatgacagatacaat
gaacccaattcatggcgtttgagcaagcgccgtgcttga

DBGET integrated database retrieval system