KEGG   Dendrobium catenatum: 110104722Help
Entry
110104722         CDS       T05027                                 

Definition
(RefSeq) 70 kDa peptidyl-prolyl isomerase
  KO
K09571  FK506-binding protein 4/5 [EC:5.2.1.8]
Organism
dct  Dendrobium catenatum
Brite
KEGG Orthology (KO) [BR:dct00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dct03110]
    110104722
Enzymes [BR:dct01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     110104722
Chaperones and folding catalysts [BR:dct03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    110104722
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C TPR_1 TPR_2 FKBP_N_2 TPR_8 TPR_19 TPR_16 TPR_12 TPR_14 TPR_11 Fis1_TPR_C RhoGEF67_u2 TPR_17 ANAPC3
Motif
Other DBs
NCBI-GeneID: 110104722
NCBI-ProteinID: XP_020689609
Position
Unknown
AA seq 576 aa AA seqDB search
MDDDFDFGTGGDDAMNEDMDLPDVDTALKVGEEKEIGNQGLKKKLVKGGDGWETPEVGDE
VEVHYTGTLLDGTKFDSSRDRGTPFTFKLGQGQVIKGWDQGIKTMKKGENAIFTIPPELA
YGESGSPPTIPPNATLKFDVELLSWSSVKDICKDGGIFKKILKEGEKWENPKDLDEVLVK
YEASLEDGTVISKVEEAEFTVKDGFFCPALSKAVKTMKKGEKVLLTVKPQYGFGEKGRPS
SGEEGAVPPNATLLIELELISWKTVTEIGDDKKVLKKILKEGAGYEKPNEGAIVKVKFTG
KLQDGTVFSKKGQDEEPFEFRTDEDEVIEGLDRAVLTMKNGEFALVTIPPEHAFGSTESK
QDLAVVPPNSTVIYEVELVSFVKDKESWDMNNAEKIEAAAKKKEEGNALFKVGKYAKASK
RYEKGAKLIEYDSSFSEEEKKQSKALKVTCNLNNAACKLKLKDYKEAEKLCTKVLEAENT
NVKALYRRAQAYIQTADLDLAELDIKKALEIDPDNRDIKLEYRTLKEKMKEYNKKDAKFY
GNMFAKMKRLEPAAESNKSEGQKLQESEPMSVDSAA
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggatgacgacttcgactttgggacgggaggcgatgatgcgatgaacgaggacatggat
cttcctgatgtcgatacggcgctcaaggtcggtgaggagaaggagatcgggaaccaggga
cttaagaagaagctggttaaggggggagatgggtgggaaacgcccgaggtcggcgacgag
gtcgaggtgcattacactgggacgctactggatggtaccaagttcgattccagccgcgat
cgggggacgccctttacatttaagcttggccaaggtcaagttattaagggatgggaccaa
ggtatcaagacaatgaagaagggagaaaatgccattttcactattccccctgagcttgct
tatggggagtctggttcccctccaacaattccccccaatgctacactaaagtttgatgtg
gagttgctttcttggtctagtgtcaaggatatatgtaaggatgggggtatcttcaaaaag
atcttgaaggagggggagaaatgggagaatccaaaggatcttgatgaagttcttgtaaaa
tatgaagctagtcttgaggacggcactgtgatatctaaagttgaggaagctgagttcact
gttaaagatgggttcttctgccctgctctttccaaagctgtcaagaccatgaagaagggt
gaaaaggtgcttcttaccgtgaagccacaatatgggtttggtgaaaagggtaggccttct
tctggtgaagaaggcgctgtacctcctaatgcaaccttgttaattgaacttgaacttatt
tcatggaagactgtcacagagattggtgatgataagaaagtcctaaagaaaatccttaaa
gagggagcagggtatgaaaagcctaatgagggggcaattgtgaaagtgaaatttactgga
aagctgcaagatgggactgtgttttcaaagaagggtcaggatgaagaaccatttgagttc
agaactgatgaagacgaagtaattgaaggattagatcgagctgtcctaaccatgaagaat
ggagaatttgctcttgtgaccattccaccagaacatgccttcggttccactgaatcaaag
caggatcttgctgtagttcctccgaactcaactgttatttatgaagtggagctagtgtca
tttgtgaaggataaagagtcttgggacatgaataatgcggagaagatcgaagctgctgca
aagaagaaggaagaaggaaatgcattgttcaaagtgggaaaatatgctaaagcctcaaag
agatatgagaagggtgctaagctcatagagtatgatagctcattcagtgaagaggaaaag
aagcagtccaaggcattgaaggttacctgcaaccttaacaatgcagcctgcaagctaaag
cttaaggactacaaggaggcagagaagctctgtaccaaggtgcttgaggcagaaaataca
aatgtcaaagccctttatagaagagcacaagcttacattcaaactgcagatctggatcta
gcggagttggacatcaagaaagcacttgagattgatcctgataacagggatataaagctg
gaatacaggaccttgaaggagaaaatgaaagagtacaacaaaaaagacgccaaattttat
ggtaatatgttcgccaagatgaagaggttggaacctgctgcggagtccaataaatctgaa
gggcagaagttgcaggaaagcgaacccatgagcgtagacagtgctgcttga

DBGET integrated database retrieval system