KEGG   Dendrobium catenatum: 110105223Help
Entry
110105223         CDS       T05027                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
dct  Dendrobium catenatum
Pathway
dct00020  Citrate cycle (TCA cycle)
dct00640  Propanoate metabolism
dct01100  Metabolic pathways
dct01110  Biosynthesis of secondary metabolites
dct01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110105223
   00640 Propanoate metabolism
    110105223
Enzymes [BR:dct01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     110105223
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     110105223
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 110105223
NCBI-ProteinID: XP_020690282
Position
Unknown
AA seq 347 aa AA seqDB search
MAPAEDSAMSRQAAKLMRSLAHRISPQQNSASSSLSSLLSQSRHFGSTPQPAVFVDKNTR
VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASV
IYVPPPFAAAAILEAMEAELDLVVCITEGIPQHDMVRVKAALNKQSKTRLIGPNCPGIIK
PGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV
DCIKRFLPDPQTEGIVLIGEIGGTAEEDAAALIKESKTEKPVVAFIAGLTAPPGRRMGHA
GAIVSGGKGTAQDKIKTLREAGVTVVESPAKIGAAMLDIFKQRGLAD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggctccggcggaggattcagctatgtctcggcaggcggcgaagctgatgcgatctctt
gctcacaggatttccccgcagcagaactcggcgtcctcatcgctttcctctttgctatcg
cagtctcgccacttcggatcgacgcctcaacccgctgtgtttgttgacaagaacacgcgt
gtaatttgccaggggattaccggaaagaacggcacgtttcacaccgagcaggccatcgag
tacggaaccaaaatggttggtggtgtgacgccaaaaaaagggggaaccgaacacttaggg
cttcctgtcttcaactcagtcgcagaggcgaaggctgaaactaaggccaatgcatcagtt
atttatgttccacctccgtttgctgcagcagctattttagaagcaatggaggctgaactg
gaccttgtagtgtgcattactgagggaattcctcagcatgatatggttcgagtgaaagct
gctctaaacaagcaatcaaaaactcgacttattggaccaaactgtcctggtattatcaaa
cctggagaatgtaagattggaatcatgcctggttatatccataagccaggacgtattgga
atcgtttcacgatcgggtactttgacctatgaagcggtttttcaaacaactgctgttggc
ttgggacaatcaacctgtgttggcattggcggtgatcccttcaatggaacgaattttgtc
gattgtattaaaagatttttaccagatcctcagaccgaaggtattgttcttattggagaa
attggaggaactgccgaagaagatgccgcggctttgataaaggaaagcaagacggaaaaa
cctgttgttgcattcattgccgggcttactgcacctccaggacgaagaatgggccatgcc
ggagctattgtgtctggtgggaagggcactgcccaggacaagatcaaaactctcagagaa
gcaggagtaacagtagttgaatccccagccaagataggtgcagccatgcttgacattttc
aagcagcgtggtcttgcagattaa

DBGET integrated database retrieval system