KEGG   Dendrobium catenatum: 110107244Help
Entry
110107244         CDS       T05027                                 

Definition
(RefSeq) sucrose-phosphatase 2 isoform X1
  KO
K07024  sucrose-6-phosphatase [EC:3.1.3.24]
Organism
dct  Dendrobium catenatum
Pathway
dct00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:dct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    110107244
Enzymes [BR:dct01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.24  sucrose-phosphate phosphatase
     110107244
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: S6PP S6PP_C Hydrolase_3 PMM
Motif
Other DBs
NCBI-GeneID: 110107244
NCBI-ProteinID: XP_020693101
Position
Unknown
AA seq 430 aa AA seqDB search
MSPSKSEKMDRFAGPARLMIVSDLDHTMVDHHDPENLSLLRFNALWESNYRHDSLLVFST
GRSPTLYKELWKEKPLLTPDITIMSVGTEITYGERMVSDSGWEKFLDEKWNRDIVVEESS
KFPQLSLQSETEQRPHKVSFYVQKEKAEVLMKSLKEILTNRGLDVKIIYSGGIDLDILPQ
GGGKGQALAYLLKKFKEDGKLPLNTLACGDSGNDAELFSIPEVHGVMVNNAQEELLKWHA
ENAKDNPKIIHASGKCASGIIEAIGHFGLGPNISPRDVENLSTCKLDNFNPGHELVLFYL
LYERWHREEVEQSATTIEIMKKITSHNGVLIHPSGVERPLHECIDAFSACYGDKKGRQFR
VWLDRVSSTQIHPDAWLVKFDKWEKSDEGRRCCLTTVVLKTKADTPEGLMLVHVHQTWMD
GFAAKKNWFF
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccttcgaagagtgagaagatggatcgttttgctggtccggcccgtctcatgatt
gtttctgatcttgaccatacaatggttgatcatcatgatccggagaacttatcgttgctc
aggttcaatgcattatgggaatccaattaccgccatgactctctacttgttttctctact
ggaaggtcaccaacactgtacaaggagctttggaaagagaaaccgttattgacaccagat
ataacaatcatgtctgtgggtacagaaataacttatggtgaacggatggtttctgatagt
ggctgggagaaatttctagatgagaaatggaatcgtgatattgttgttgaggaatcatct
aaatttccacaactttcattacagtcagaaacagagcagcggccacacaaggttagcttt
tatgttcagaaggagaaggccgaggtactgatgaagtctcttaaggagatcttgacaaat
cgtgggcttgatgtgaagataatttacagtggtggcatagatcttgacatattaccacaa
ggtggtggaaaaggccaggcactggcatatttactcaaaaaattcaaggaagatgggaaa
ctaccactcaacactctagcttgtggtgattctggcaatgatgctgagctatttagcatt
ccagaagttcatggtgtgatggtcaacaatgctcaagaggaactattaaagtggcatgca
gaaaatgctaaggataatcctaagataattcatgcaagtgggaaatgtgcttctgggatt
atagaagctataggccattttggacttggtcctaatatatctcctagagatgttgagaac
ctatcaacttgcaagcttgacaacttcaaccctggacatgaattagtgctcttttacttg
ttgtatgaaagatggcatcgggaggaagttgaacaatctgctactactattgagatcatg
aagaagattacttctcacaatggtgtgttgattcatccttctggagttgagagacctctt
catgaatgcatagatgccttttctgcatgttatggtgacaaaaaaggcaggcagtttcga
gtatggctggatagagtttcttctactcagattcatccagatgcttggcttgtgaaattt
gacaagtgggaaaagtcagatgaagggcggcgatgctgcctaactaccgtagtgctgaaa
accaaggcagacacgcctgaaggactcatgctggtacatgtccatcagacttggatggat
ggctttgctgcaaaaaaaaactggttcttctaa

DBGET integrated database retrieval system