KEGG   Dendrobium catenatum: 110109286Help
Entry
110109286         CDS       T05027                                 

Definition
(RefSeq) protein PHYLLO, chloroplastic isoform X1
  KO
K14759  isochorismate synthase / 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase / 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase / O-succinylbenzoate synthase [EC:5.4.4.2 2.2.1.9 4.2.99.20 4.2.1.113]
Organism
dct  Dendrobium catenatum
Pathway
dct00130  Ubiquinone and other terpenoid-quinone biosynthesis
dct01100  Metabolic pathways
dct01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dct00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    110109286
Enzymes [BR:dct01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     110109286
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     110109286
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     110109286
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     110109286
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N Abhydrolase_6 TPP_enzyme_M_2 MR_MLE_C Abhydrolase_1 Hydrolase_4 TPP_enzyme_C Ndr Abhydrolase_2 Thioesterase Abhydrolase_3 BAAT_C DLH Esterase DUF2974 PGAP1 DUF676 DUF915
Motif
Other DBs
NCBI-GeneID: 110109286
NCBI-ProteinID: XP_020695934
Position
Unknown
AA seq 1722 aa AA seqDB search
MKLQSSGFFHSSKPSLLHSNHRIRSHSLFIPSSPFRLSLPFHCRNHPGLFYLRSNPNSQI
YAQKEFCARELNIVVDEFVETGCSDLPVELCLTRTLDPALTLMQAVNAMKEAVNKLKIDP
PCSRSGVLRFQIVVPPSVKSLNWLYLQCKSLAPFPQIYVATTKMHERFNGLTITTQMLGV
SGVGSAITFCGSSGVLRGYNLMERYLSLESPLISAYGFIGIDWNMESKKMFNHPGSFYFF
IPQIEVNEFENVSFLASNLVWDNSLSYPLEEAVHSLERSLNQINVHVSSASTLVVDKWNW
FEGQSGIEGKEDFKMVHINAETLQKMHASGRFSSLEELTGTDKSYYRNSTTVIVSKNMFR
LPHGTSKIKECTNINLLWASLIVEECVRLGLKYFCIAPGSRSSPLALSACSHSLTTCISC
YDERSLAFHALGYARGSHKPAVIITSSGTAVSNLFPAVVEASQDFVPLLMLTADRPPELQ
DVGANQAIDQVNHFGKFVRFFYSFPPPSDQIPARMVLTTIDSAVYSATQSLCGPVHLNCP
FREPLEDVPKEWATDCLRGLDLWMSKEEPFTQYIKIQHAWGHCYDQMAKVLDVIHNANQG
LLLLGAINTDDEIWAALLLAKHLSWPVVPDVLSGLRLRKLLTSCPGIEDDFLFLDHLDHV
LLSESVKSWLQPDVVVQIGSRITSKRVSQLLDSCSPFVYIFVDKHPNRQDPSHLVTHRVQ
CSIVEFTELVLVDKCPKRGRKWSLLLKELNLMVAMEISFQIYSEISLTEPYVAHLVGQVL
RGDTALFIGNSMAIRDMDMYGKGWLKPNHDSVFMETSCNLAFMGLRVSGNRGASGIDGLL
SSSIGFAVGSKKRVVCVIGDVSFLHDTNSLAILSNRTRRKPMTIIVINNHGGAIFSLLPI
ASRTQESVLNQYFYTSHNISIGKLCSAHRVKHLLVQTKMELQHALHESQQDYGDFVIEVE
SCITDNAKFHSIVRKSSGQAADQAFRALSVTPMTEIVTDSLSICKICNVEYSLYRIQLCA
PTSTQMKHYRKDFYHEGFVLAISLDDNIVGYGEIAPIEIHKENLLDVEEQLRFLVHVMEG
AELSCLLPLLRGSFSRWIWKILGIPPSSVFPSVRCGMEMAILNALAKRQGSSLSGFIGYE
SFLLGTQKVADKNICKEEGIPICALVDCDGTPNVVAHVVSQLFHDGFTTVKIKVARREDP
TEDAAVISEIRAVIGYKINIRVDANRKWSYDKAFHFGSSVKSFALEYIEEPVCFEDDIIK
FCEETGLPVALDETIDNISGEALQKLEKFVHPGIVAVVIKPSMVGGFENALLIAKWAQMH
EKMTIVSSAFESSLGLSTYVKFAHYLDQLNKSISEMRKVKQTAPAAHGLGTFQWLKEDVS
TEGLRIRIPPHGKTVEASIGDTDIFLRNFQVNPEVIQRIYRGEQVKSYKSEVDCNGLSCS
FKLMEAGGNKDGNLIFLHGFLGSGQDWIPLMKAFSATTRCISIDLPGHGDSCVQWHKKNL
TQEPYQSIESVAEMLLQLINNITIGKVILVGYSMGGRIALYMSLKYCEKIHGAVLISGSP
GLRNENAQRIRLSQDEARASYLLSHGLNSFLETWYEGSLWKSLRAHPLFNKIVRQREKHQ
DIRSLAKSLTDLSTGRQRPLWDELRHCKNPVLLIVGEEDLKFRRIAEEMCNEIKSSCADE
VTGQEDLCEMVIVPECGHAVHLENPFPVINAVRKFFTRVNRK
NT seq 5169 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgcagagttcaggtttcttccattcctcaaaaccctctctcctccactcaaat
caccgcatccgcagtcattcattgttcatcccttcttccccatttcggctctctcttccg
ttccattgccgaaaccaccccggacttttctacttacgctcaaaccctaattctcagatt
tatgctcagaaggaattttgtgcccgggaactgaacatcgtagtcgatgagttcgtggaa
actggttgttctgatttgcctgtagaactttgcttgacgcgaactttggacccagctctg
acccttatgcaggccgtaaatgcgatgaaagaggcggtcaataagctgaagatagatcct
ccctgctcgaggagtggtgtgctgaggtttcagattgttgtacctcctagtgtcaaatcg
ttgaattggttgtacttgcaatgtaagtcgttagctccttttcctcaaatttatgttgca
acaacaaaaatgcatgagcggttcaatgggcttacaataacaactcaaatgcttggagtt
tctggagttgggtcagcaattacattttgtgggtcttcaggcgtcctcagaggatataat
ttgatggaaagatacctttcccttgaatcacctcttataagtgcttacgggttcattgga
attgattggaacatggaatcgaaaaaaatgtttaatcaccctggttcattttattttttt
atccctcagatagaggtgaatgaatttgagaatgtttctttcctggcatcaaatttggtt
tgggataattccttatcatacccattagaggaagcagtccattccttggagagaagtctc
aaccagattaatgtccatgtttcctctgcgagcactctcgttgttgacaagtggaactgg
tttgaaggtcaatcaggcattgaagggaaggaggactttaaaatggtgcacataaacgct
gaaactctccaaaaaatgcacgccagtgggagattttcttcattggaagagctcacaggt
actgacaaatcttattataggaattcaacaacagtcattgtcagcaagaacatgttcaga
cttcctcatgggacaagtaagataaaggagtgcacaaacatcaatcttttatgggcatca
cttatagtcgaagaatgtgtccggcttggtttgaagtacttctgtatagctccaggttca
agatcatctccacttgcactttctgcttgtagccattctcttactacttgcatatcttgt
tatgatgagcgttcacttgcctttcatgctcttgggtatgcaaggggatcgcataagcct
gcggttattataacatcatcaggaactgctgtgtcaaatctgtttcctgcggttgtggaa
gctagtcaggattttgtgcctctccttatgcttacagctgataggcctcctgaactacag
gatgttggcgctaaccaagccatcgatcaggtcaatcattttggaaaatttgtgaggttc
ttctacagctttccaccaccttctgatcaaatccctgcaagaatggtcctcacaaccatt
gattctgccgtatatagtgcaactcaatccttatgtggccctgtacatcttaactgccct
ttcagggagccactggaagatgttcctaaagaatgggctactgattgtttgagaggacta
gatttatggatgtcaaaggaagaaccttttacccaatacataaaaattcagcatgcctgg
ggtcattgttatgatcagatggccaaggttctagatgtgatacataatgctaaccaaggc
ctactgctacttggtgctataaacactgatgatgaaatttgggctgcacttcttttagcc
aaacacctgtcctggccagttgttcctgatgttctctcaggtctacgattgcgcaaacta
ctgacctcatgcccgggtattgaagatgactttctatttcttgatcatttagatcatgtt
cttctatcagaatctgtcaagagctggctacaaccagatgtggtggttcagattggcagc
aggattacaagtaagcgtgtcagtcaattgcttgactcatgctctccatttgtatatatc
tttgtagacaagcatcccaatcgacaagatccttctcaccttgtcacacatagggttcaa
tgcagcattgttgaatttactgaacttgtcctggttgacaaatgcccaaaaagagggagg
aagtggagtctgcttttaaaggaattaaatctgatggttgcaatggagatatcatttcaa
atatattctgaaatctctttaaccgagccatatgttgcacatcttgttggacaagtcctt
agaggtgatactgcattatttattgggaatagcatggccatacgggatatggacatgtat
ggaaagggctggctgaaacctaaccatgattctgttttcatggaaactagttgcaatctg
gcattcatgggattgcgtgtatctggaaacaggggagctagcggtattgatggtcttctt
agcagttccattggttttgctgtaggaagcaaaaaacgtgttgtatgtgtgattggtgat
gtatcatttcttcatgataccaatagcttggcaattcttagcaataggacaaggagaaaa
ccaatgacgataattgtcataaacaatcatggtggagcaatcttcagtcttctgcctatc
gctagtaggacacaggaaagcgtgttaaaccaatacttttacacatcacataatatatca
attggaaagctatgcagtgctcacagagtgaagcatttactggtgcagacaaaaatggaa
ctgcagcatgctttgcacgaatcacagcaagattatggtgattttgtaatagaagttgag
agttgcattacagataatgctaagtttcacagcatcgtaaggaagtcttctggtcaagct
gctgatcaagcatttagagccctttctgtgactccaatgactgaaattgtcactgatagc
ctgtctatttgtaagatctgtaatgtggagtactcactatatagaatccaactttgtgct
ccaacttcaactcagatgaaacattatagaaaagatttctatcatgaaggctttgttctt
gcaatatcattggatgacaacattgtaggatatggcgagatagctccaatagaaattcac
aaagagaatttgttggacgttgaagaacagctgagatttcttgttcatgtaatggaagga
gctgaactaagttgtcttcttccgttgcttaggggctctttttctcgttggatatggaaa
atcttgggtattccaccctcctctgtctttccaagtgtaagatgtggcatggaaatggct
atacttaatgcattagcaaaaaggcagggttctagcttgtcaggcttcattggatatgag
agcttcttgttaggtacacaaaaagtagctgataaaaacatatgcaaagaagagggaata
ccaatctgtgcacttgtggattgtgatggaactcccaatgtggtagctcatgttgtttct
cagctgtttcatgacggttttactacggtaaagatcaaggttgcacgacgagaagaccct
actgaagatgctgctgttatcagtgaaatcagagcagttattggctataaaattaatatt
cgtgtggatgcaaaccgcaaatggagctatgacaaggcatttcattttgggtcttctgtt
aaaagctttgcattagaatacattgaggaacctgtatgttttgaagatgatattatcaaa
ttttgtgaagaaactggcttgcctgtggcactagatgagacaattgacaatatcagtgga
gaagctcttcaaaagcttgagaagtttgtccatcctggcatagttgctgtcgttatcaaa
ccaagtatggttggaggatttgaaaatgccttactcattgcaaaatgggcccagatgcat
gagaagatgactattgtaagtagtgcatttgaaagtagtctgggcttgtcgacatatgta
aaatttgctcactatcttgaccaactcaacaaatcaatatctgaaatgcgaaaagtaaag
cagactgctcctgcagcccacggtcttggaacatttcaatggttaaaggaagatgtatcg
actgaaggtcttagaatacgtattcctccacatggaaaaacagtagaagcctctatagga
gatactgatatcttccttagaaattttcaggtaaaccctgaagtaattcagaggatttac
agaggagaacaagtcaagtcgtacaaatcagaagttgactgcaatggtttatcttgttca
tttaagttgatggaggctggtggaaataaagatggtaaccttatctttcttcatggattt
ctcgggagcggccaagattggattccattgatgaaagctttttctgctactacacgatgc
atctctattgatcttccagggcatggagattcttgtgttcaatggcataagaaaaattta
acacaagaaccttatcaatcaatcgaatcagtggctgaaatgttgctgcaattgattaat
aatattacaattggaaaggtcatcctggttggatactcgatgggaggaaggattgcattg
tacatgtctctgaaatactgtgaaaagatacatggagctgtcttaatatcaggaagtccg
ggtttaaggaatgaaaatgctcagaggattcgcttatctcaagatgaagcaagggcttcc
tacttattgtctcatggacttaacagtttcctggagacatggtatgaaggcagcctatgg
aaaagcttaagggctcatcctctcttcaataagatagtaaggcagcgtgaaaaacaccaa
gatatcagatctcttgcaaaatccctcactgacttgagcactggaaggcaaaggcctctt
tgggatgaactaaggcactgcaagaatcctgttctactcattgtgggagaagaagatctc
aaattcagaagaattgcagaggagatgtgcaacgaaatcaaaagctcttgtgctgatgaa
gtcaccggtcaagaagatttatgtgaaatggttatagttccagaatgtggccatgcggtg
catttggagaaccctttcccagtcattaatgctgtgaggaaattcttcacaagagtgaac
agaaaatag

DBGET integrated database retrieval system